CAZyme Information: jhhlp_000275-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000275-t41_1-p1
• CAZy Family: AA16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	NLAX01000002|CGC7	49401.42	4.3359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000002:361099-362608(-)

Full Sequence      

MHSKLNFSRITATFLILVLPALAQSCDVELQPDYGAPVAHGGWEYRIIANGLQRPRGIVV
DSHGALLVVDSGVGIKRLVLDDKGGTCFSVSEQSTLVERSELNHGIALDNENGVLYASSS
DKVYSWSYNAEDGTVGETRNTVVKGMDNSGHTTRTLLLSQKSPGTLLISRGSDGNLDEEA
KDIETGHCQLKAFKVADVKDALDFTSDGTIIAWGLRNSVGVAEDPATGGIWSVENSVDQL
RRNGRDIHQDNPGEEMNFHGYLNSSTEETGANYGYPSCFALWSTDGFPDQGDLKTGNQFA
PSEDDGVNDQKCNSDFVAPRITFQAHTAPLDIKFTEDGSEAIVSFHGSWNRDEPAGYVLS
SIPFRDGQPVAASDSMDAAENILSNADVGDCPGNCFRPVGLAWGSDGRLFMTSDATGEIF
ALQKTGASNGSSGDDENSAGRSKERSWFALIPVGILGLVFL

Enzyme Prediction     

No EC number prediction in jhhlp_000275-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	32	422	1.1e-165	0.9825436408977556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	3.34e-22	8	426	23	398	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
271333	NHL_like_5	0.002	47	116	189	256	Uncharacterized NHL-repeat domain in bacterial proteins. The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.
271327	NHL_like_2	0.009	41	150	95	189	Uncharacterized NHL-repeat domain in bacterial and archaeal proteins. The NHL (NCL-1, HT2A and LIN-41) repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97414.1|AA12	6.48e-165	5	433	3	440
UQC90985.1|AA12	6.95e-164	21	428	122	515
UNI18151.1|AA12	5.46e-162	17	458	23	473
QYT00796.1|AA12	3.56e-161	23	434	22	437
QPC72375.1|AA12	1.82e-157	9	443	6	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	1.25e-148	29	425	3	403	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.29e-148	29	425	4	404	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.33e-148	29	425	5	405	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	2.62e-71	25	424	4	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q44091|SNDH_GLULI	3.62e-17	36	425	71	444	L-sorbosone dehydrogenase OS=Gluconacetobacter liquefaciens OX=89584 PE=4 SV=1
sp|O51055|Y024_BORBU	1.53e-09	7	422	10	374	Uncharacterized protein BB_0024 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0024 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002835	0.997138	CS pos: 23-24. Pr: 0.8548

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000275-t41_1-p1.