CAZyme Information: jhhlp_000268-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000268-t41_1-p1
• CAZy Family: AA13|CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		82765.84	5.8690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000002:322893-326515(-)

Full Sequence      

MAETVEPKSPPPKLSALPPTDYFTQTQWAILFALLDASLPSLATKSSIKDRKTQVELPDA
TFDKAYARVKEVCVDVPSEDVFRELLADRCSTDPEFIDNCKRFISGFPVDHKKALGDALH
KLSTRVGAWFLTGYCTPYHQLPVHVQEKIILSWRQSWIPQLRVLAKTVQQMAQKAYFQTN
PLFKKLSTYDDVPRNYEPGAAFDFRFLQFAAGSAAETIETDVVIVGSGPGGSVCARTLAE
AGYAVHVVDKGYYFPPSQLPMPQPEACEHLFEQQGVVTSEDKSASLVMGTCWGGSGTINW
SVSLQTQQYVREEWATKDGLPFFTSDRFQECLDRVCGAMGVSGDQCRHNHGNRVLLESAE
KLGWEAKVAPQNTGGKEHYCGQCHLGCGSNEKMGPVVSYLPAAARAGAKFIEGFEVERVV
FEDEETREKAVGVVGRWVSRDANGSVEGPLEERVTRRVMIKAKKVIVSSGSLWSPVILKK
SGLENPNIGKNLHIHPCNFLAASFKEDVKPWEGGIITSYCTQFENLDNQGHGTKLEPTCM
VPYAALASFPFASPLDAKLASLKYRHMNSFISLTRDRDSGYVTVDECTGRPRVHYTPSAF
DAAHTLEGVVGLAKLCYVAGAVEIYAFVPWLEPFVRTTFPAAGGDGDGDGKGGQLSATEL
MDRDEEFAAWLGKVRELGNRPPLGVWTSAHQMGTCRMSSREDEGVVDPRGRVWGCEGLYV
ADASTFPSASGVNPMVTNMAIADYIAGNVVEDLKG

Enzyme Prediction     

No EC number prediction in jhhlp_000268-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	213	750	2.7e-71	0.9762773722627737

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	6.12e-55	268	497	2	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	5.40e-43	221	742	9	526	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.02e-29	576	745	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	3.41e-09	664	748	457	534	choline dehydrogenase; Validated
223717	FixC	5.75e-08	217	251	1	35	Dehydrogenase (flavoprotein) [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	1.62e-206	14	753	16	734
UPL02707.1|AA3_3	1.95e-15	219	753	13	602
CEI62196.1|AA3_3	6.01e-15	214	754	8	603
CEF78478.1|AA3_3	1.81e-14	214	753	8	602
QPC70859.1|AA3_3	5.50e-14	214	753	8	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.12e-08	217	754	3	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4QI7_A	6.10e-08	218	750	228	764	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
7DVE_A	1.76e-06	661	753	412	512	Chain A, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum],7DVE_B Chain B, 6'''-hydroxyparomomycin C oxidase [Microbacterium trichothecenolyticum]
5HSA_A	3.43e-06	219	753	6	636	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
4UDP_A	7.01e-06	221	750	7	528	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	1.22e-84	122	754	103	747	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|B5WWZ8|FAO1_LOTJA	1.19e-80	218	754	235	745	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	3.95e-75	218	754	236	743	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|O65709|FAO4A_ARATH	9.61e-75	112	754	57	723	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9ZWB9|FAO1_ARATH	2.83e-70	218	754	244	753	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000051

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000268-t41_1-p1.