CAZyme Information: jhhlp_000209-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000209-t41_1-p1
• CAZy Family: AA12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	NLAX01000002|CGC5	58574.37	4.1796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000002:71396-73192(-)

Full Sequence      

MRQKTRWLPLAALFTGVVANDKIDAVREVFKRSWDGYRKYAWGHDSLRPITNSFFDDRNG
WGASAVDALSTAIIMGEEEAVKDILEFIPTIDFSTTTTQVSLFESTIRYLGGLLSGYDLL
QGPYKELAPSKEAVDSLLEQAIRLADLLKVAFDTPSGVPDNDLAFDPDPRRIGTADNWIA
TVGTLVLEWERLSDITGNAEYGELAKKGESYLLDPQPPEAEPFPGMVGSRVWVENGTFVD
AMGGWNGGTDSFYEYLIKMYVYDPVRFESYKDRWVLAADSSMEYLASHPTTRPDLTFLAM
YLGQTRYFYSGHLSCFHGGNFILGGTALNEPRYIDFGLELTAGCRESYVQTTTGIGPELF
QWQDNATALDAANNQPPPEQQVDFYEKAGFWLVNSQYSLRPEVIESYYYAYRATGDDMYR
KWAWDAFVKINNTCSVGSGLSSIYDVQLVDGVTMFYDFQESFWFSEVLKYVYLILVDEDS
EVQVRKSGRDLWVYNTEAHPLRVFDGSSTEAEDGWIED

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	30	503	1.6e-127	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	29	503	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.18e-112	19	505	69	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58874.1|GH47	2.32e-221	17	506	34	520
ERS98086.1|GH47|3.2.1.113	8.75e-214	21	508	39	530
CAP66683.1|GH47	1.05e-213	22	515	63	553
CDP28418.1|GH47	1.05e-213	22	515	63	553
VBB80036.1|GH47	4.09e-213	22	515	62	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	6.21e-189	22	503	5	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	2.17e-188	22	503	40	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	1.88e-177	25	507	18	496	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
1NXC_A	1.45e-61	21	512	19	474	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	1.64e-61	21	503	21	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31723|MAN12_PENCI	1.12e-187	22	503	40	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q0D076|MNS1B_ASPTN	1.08e-184	18	503	35	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	2.40e-182	22	503	42	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	3.07e-182	19	503	37	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	3.07e-182	19	503	37	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.693275	0.306723

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000209-t41_1-p1.