CAZyme Information: jhhlp_000171-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000171-t41_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507	NLAX01000001|CGC3	55942.56	6.9257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000001:818035-819683(+)

Full Sequence      

MDLPKKVLFFTNSDYGQANVILATAHTLLLTQSVEIHIASFHGLEAAVRSMSNMALSQSS
TTGVRNSIVFHSLQGISWGPASFRPETGVAASLDLKPGLRNSAACVSRLPTILLPWHPDE
FMTIYREAERILEEVNPNLTIVEPLFTQAMTLCHRSKVNWAVLAPNTIKDFAIPKQPNLA
MLWKYPLVCSAMPYPLPWALIPRNIALNLVAGYALVTDTRIKEITRILHHEVDPTVNLIT
ANELGVLKSPPPGIRILVANSPDLDYHFDFFPDYIVPCGPIIRPTDPVAAADPDLAAWLD
RGPTVYVNLGTHLKATPTEATEMAHAYRAVLDYAREHNLGPLQILWKIGRKHVDGEKLEQ
DNFDGSWKPVLDTLRPELDAGRMRLTDWVTVEPGSVLQSGRIVCSIHHGGASSFYEALCA
GIPQILLPPWSDCYDFANRTELLGVGRWANKKAKPRWERSELASCIIDVLFGPESTKILA
RAKAVAAQHPEGAGREKAAREIIALVA

Enzyme Prediction     

No EC number prediction in jhhlp_000171-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	284	507	9.6e-16	0.42408376963350786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.42e-21	110	505	53	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	6.10e-14	163	507	95	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	2.08e-08	275	482	225	425	UDP-glucosyl transferase
177813	PLN02152	1.03e-05	159	432	117	376	indole-3-acetate beta-glucosyltransferase
178170	PLN02555	2.05e-05	264	503	230	464	limonoid glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI70655.1|GT1	5.28e-199	1	503	1	509
CCT74337.1|GT1	7.77e-198	5	503	5	506
QGJ00663.1|GT1	7.77e-198	5	503	5	506
QGI69774.1|GT1	7.77e-198	5	503	5	506
CZS86005.1|GT1	9.94e-197	1	503	1	509

PDB Hits     

jhhlp_000171-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	5.61e-73	7	506	8	488	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	9.69e-73	7	468	8	443	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	4.24e-10	308	502	370	558	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	3.00e-09	383	500	443	557	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000171-t41_1-p1.