CAZyme Information: jhhlp_000149-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000149-t41_1-p1
• CAZy Family: AA11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697		75919.41	3.9706

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000001:718333-720792(-)

Full Sequence      

MVRYVRTSLLALFAPSLVAAIPAPWLRARHVTNQTDLKDSYDYIIIGGGTAGLTIADRLS
ESCKYDVLVIEHGDFYDPANPVNRGTRQYSIRSVPQVELNNRTTVISMGFCVGGSSAVNG
MAVMRGTKTDYNIWAELGNENSTWGWDGMLPYFKKAIHFVPPDEVFAADFNITYDVEAAW
GQYDDTHVYASFPGGNDPRIKIHYEALKSVPGIDFPKDGHAGSQGVFWYPVSVDPATGQR
SYARTGHWDGLNRANLDLLTASRVNKILFEDDVATAVQFVPREGGEGTTVTAKREVILSA
GSIHTPQILQLSGIGPAEHLEAAGIEVQVDLPGVGANFQDHPVGPGIFFQWGETPPTPEI
QSNLTPSVGGGQGLVAFLDLSIAAPDEYEEIASRYESLDLSEYVAPDTAETVLAGYKAQQ
EIYAREMRGRGLSFMNYIIGGGAGGSPINLHITSRGTIRLNVTNPEADPVVDYRALSNPT
DIDLMAAYLKFLRRFFTSGELEQYNATEVRPGESGQTQEGLEEFIRAGYSPQGWHPIGTA
AKMRRELGGVVDDDLRVYGVQNLRVADASIMPTLISGTTQLTAYTIGEKASAADLIKSAW
EDDEKEVCPQPEVPEDEEVEETEGEDGEEEEEEEVEEGEGEGVDEEDEAEQGPDEGVEEG
GEETGDEDVDEEFDGDEPGKDMVDVDEGEEDDVGNED

Enzyme Prediction     

No EC number prediction in jhhlp_000149-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	597	2e-149	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.02e-86	35	599	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.91e-82	40	597	5	532	choline dehydrogenase; Validated
274888	Rv0697	3.07e-47	42	592	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.98e-36	453	590	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.09e-34	41	343	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB86206.1|AA3_2	1.32e-209	20	600	63	624
CDP31727.1|AA3_2	1.64e-193	20	598	63	626
VBB71339.1|AA3_2	1.42e-171	37	597	23	606
CDP22349.1|AA3_2	7.78e-166	37	597	23	597
VBB78527.1|AA3_2	2.60e-160	33	598	28	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.34e-99	4	605	3	647	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.30e-94	36	597	1	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	6.60e-58	40	597	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
1CF3_A	1.97e-48	26	595	4	576	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]
5NIT_A	3.57e-48	26	595	2	574	Glucose oxidase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	8.74e-101	6	597	3	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.21e-68	33	596	38	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.21e-68	33	596	38	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	8.96e-68	9	597	8	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.47e-62	6	597	3	608	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.026286	0.973676	CS pos: 20-21. Pr: 0.9112

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000149-t41_1-p1.