CAZyme Information: jhhlp_000129-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000129-t41_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	NLAX01000001|CGC1	68610.39	5.8895

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000001:613792-615742(+)

Full Sequence      

MLSSRCRSRYILLGLFTTFFFYCYLSSEPEPGYTVPLALATSALASERLEWYMNHNPPPS
PPSTKSFDWGKVPVANRPGRLTHLPSGRPKDLPPIQYNFPLDGWSRNTAKQRETRRQQVK
ALFFKNWDSYRKYAWKKDALLPLSSSGRDQFSGWAATLVDSLDTLWIMGFRKEFDEAVAA
VAEIDFGQSTSTRVNTFETNIRYLGGLLAAYDLSRREILLTKAIELGDLLYTAFDTENRL
PVDNIDFERAKEGGGLLAEGIVVAAGPGTLSLEMTRLSQLTGNPKYYDAINRVTRLFAKQ
QMETSLPGMWPMYVSMAREDTKYGRTFTLGGNADSMYEYLPKMYAMLGGLEPVYEKMSRA
FMRTATANLFFRPMVPKGDDILISGNVNVDSEDVPVLDPESEHLACFVGGMMALGGRLFS
NQTDVDNGARLAKGCAYVYRSFPTGIMPERFNMVVCPGPDKMPRSCHWDEDVFGVEAGKR
PEYKETLPRGFTTAKDPRYLLRPEAIESLFVLYRVTGEEVYVDMAWDMFRAVREGTATEI
ANAAVLDVTVAKEKTKKGELPKEDYMESFWLAETLKYFYLIFSPPDLISLDDYVLNTEAH
PFRRPR

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	123	604	1.7e-155	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	127	604	6	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.10e-125	83	605	41	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO62211.1|GH47	1.26e-247	43	605	45	603
QYT04436.1|GH47	1.94e-240	33	603	26	586
UQC90072.1|GH47	3.40e-239	49	604	42	589
UKZ95051.1|GH47	4.34e-239	7	603	5	585
UKZ82405.1|GH47	4.16e-237	48	603	38	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	1.40e-61	115	601	5	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.61e-61	115	601	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	1.69e-61	115	601	10	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.89e-61	78	601	61	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]
1KKT_A	7.60e-61	106	601	31	505	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C512|MNS1_ARATH	3.83e-68	115	603	97	535	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|Q8H116|MNS2_ARATH	6.95e-68	115	603	98	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	2.54e-63	113	603	37	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.08e-61	113	603	40	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	7.86e-61	113	603	40	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999973	0.000065

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000129-t41_1-p1.