CAZyme Information: jhhlp_000100-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000100-t41_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	NLAX01000001|CGC7	62072.27	6.6766

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000001:458623-460553(-)

Full Sequence      

MKWSSGLSLFGLFAAVAQASSTCKCYPGDSCWPSQSKWNALNIAVGGRLNVELPPGLPCF
ATYEGQTVAGANDPAKCAEVTAKWSDPDWVASLGSWPMLPFWSNSTCYPSNAGSCTSDCK
QGVVPTYVIKATKVSDIQAGILFAKTNNLRLIIRNTGHDFMGRSVGYGALVINTWRLKDI
TLHNKWTGPGDYKGKAVTAGAGVMIHELYDKVWAANQDVLAGECPTVGVAGGYVQGGGQG
PLSGVYGLASDNALQFTAVLADGRHVTANSRTYSDLFWALKGGGPGTFAVVTSVTFKTFD
RVPVSGMALNIVGSGDTFWEGYRIWYTFGPELVKHGIYVWYAASEGNIIAQPFVAPNKTK
AELEAILQPMLASLDAAGVSYTASEVQTFPNFGELYNEMWFTAYHAANGQAGFGGRLVSL
TDAVGNGDNIVAAFREVLAKYPAVGFGGHLVNPGNGVADPNQDLSAVHPVFRNTADILVY
LYFLEDCLSAERRAEVLDAVTNDIGAILRRETPTSAVYSNEGDVNEPNWQNAFWGSRVYA
KLLKLKEKYDPNRVFWVKSTPGSEKWKLVNEKLCKA

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	124	331	2.1e-48	0.43013100436681223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	2.13e-16	123	555	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.79e-14	125	269	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	7.60e-09	517	556	1	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	2.05e-54	14	575	491	1065
QKD57322.1|CBM91|GH43_11	2.05e-54	14	575	491	1065
CCA69005.1|AA7	9.82e-25	124	555	57	478
QRW06655.1|AA7	1.11e-20	125	563	68	497
QRV77710.1|AA7	1.11e-20	125	563	68	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	9.41e-79	20	576	25	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.74e-61	17	564	24	585	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
4PVK_A	5.28e-21	97	303	21	227	Phl p 4 I153V N158H variant, a glucose oxidase [Phleum pratense],4PWC_A Phl p 4 I153V N158H variant, a glucose oxidase, 3.5 M NaBr soak [Phleum pratense]
4PVH_A	7.04e-21	97	303	21	227	Phl p 4 N158H variant, a glucose dehydrogenase [Phleum pratense]
4PVJ_A	1.25e-20	97	303	21	227	Phl p 4 I153V variant, a glucose oxidase [Phleum pratense],4PWB_A Phl p 4 I153V variant, a glucose oxidase, pressurized with Xenon [Phleum pratense]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G0R6T3|SORD_HYPJQ	6.01e-103	19	575	35	572	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	8.61e-96	12	576	16	563	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A0A1V6PBT1|CALF_PENDC	2.51e-84	7	566	10	564	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1
sp|D4AS41|A7056_ARTBC	5.15e-83	7	576	11	588	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|G2QDQ9|VAO15_MYCTT	4.84e-78	20	576	25	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999802	CS pos: 19-20. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000100-t41_1-p1.