CAZyme Information: jhhlp_000037-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000037-t41_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	NLAX01000001|CGC2	72809.53	4.6560

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000001:138887-141169(+)

Full Sequence      

MAPILSFVGPAKLVSSLLIIGLIAVDHVTALPGHASSASIVKRQAHLREEYDYIVVGGGT
VGLTIADRLTEDKDTTVLVIEYGYLDSSNAITAMGPDVNIRSDHEMPRDTRYYNITSPPM
EGLNNRTKNVAAGCVVGGSSAVNGMIFDRGSAEDYDAWVWATGDWQEEYGKEWGWDNLLP
YFRKSVTFHPPDERMEEEYGMTADAEAAYGGSTPIHSSYSPFQWPAQKLMWDAFKSVEGI
DFPVEHADGHAVGVFWFPNSIDPSTRTRSYARLGHYSQENGPHTRTNFHLLPGHRVTQLM
LNEVDDADSAEGWEAVGVKFTPRDGDMPAKAYEVRARKEVIVSAGTLHTPQVLQRSGIGP
RDVLEAAGVEVKYHLPGVGWNFHDHQMWSATWSWGVDVKPSADTLASDPEYAALANELWE
ANKTGPHAAYTNSGAFLPLSVLTEEFSQIVDQVLAQEPTEYLPAHLDETLVAGYKQQLEI
LARQLNGTNSAVLELIFTGVGAFSPINLRVLSRGYVYLSPDDDGATGRGDVEPIVDYRAL
TNPIDVALNRALLKFMRRFFTSEAMVEALDPAEVSPTMDADSDEFEQWLRQTMNPSVAHP
SGTCALGPVELGGVVGPDLRVHGTKRLRVADCSIMTLVPGTHTSSTAYAIGEKAADLIRG
QRTVD

Enzyme Prediction     

No EC number prediction in jhhlp_000037-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	50	659	1.3e-150	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.78e-71	49	660	4	533	choline dehydrogenase; Validated
225186	BetA	5.58e-61	49	660	6	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.53e-38	52	659	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.14e-30	512	654	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.47e-23	124	385	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00954.1|AA3_2	2.01e-155	51	659	25	602
AEO63808.1|AA3_2	7.20e-151	30	659	21	635
VBB80399.1|AA3_2	3.30e-146	29	659	17	628
UQC73730.1|AA3_2	1.07e-141	29	661	24	646
CDP28753.1|AA3_2	4.60e-139	29	653	17	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	2.02e-114	35	658	15	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.22e-98	46	659	1	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	3.35e-57	50	662	1	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4H7U_A	3.48e-57	50	658	40	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	1.72e-56	50	662	2	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.28e-97	38	661	25	616	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.13e-78	18	659	7	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	4.74e-64	47	659	10	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	4.74e-64	47	659	10	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.58e-62	49	660	45	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000700	0.999277	CS pos: 30-31. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000037-t41_1-p1.