CAZyme Information: evm.model.AC2VRR_s00251g169-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00251g169-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646		70820.26	6.4074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC251:331580-333629(-)

Full Sequence      

MHSPRNQNMNTFNEPPSERVWKDTTAGETYGSYFADQNEQMRRSNRTTFSGTNGGAHHAD
IAVGLLDSGENVLRKPHYTGRKRTWPGALFLLLLIFTSLALITYYGIQTHSESKEQEELS
QEIIGRGRRRKKALPPKVCVVPNYVTSGTKIYAKHGSVKHEVHFTGVNWSGMENIEGIPH
GLAYKQSDVDTIAQKLAKHKFNAVRLPLNAKMIIEDSPVDTKDFLNVYQNPDLVVETYVD
MIKKVVQALAKQQIVVLLDIHKIDPAFKEDTSEHLWYTKEFPIEVMLKMYQKLASELCNE
FYYNIVGIDIKNEPIGGCWPAKAGSKECPPNRDWPRAVEAIGNAILEVCPNWLIVAEGLY
AQNIKATINGKSVVYSDWYGASASNATLNPIVLSIPNKVAFAVHWYSPSVYPTSVYFQSQ
KTEKDGSISVVEYPTTPAGDALLHSGMKTIMDKAFGQLLDLAEAPVFYGEFGGIYGKAEL
LPGKTSTRAIEYMMEYGSARGMVGGFIWSLNPDGHYAFNDKYETDDPFQYGLYADKTYQD
FHDDYSVALQQLEGNGVIPCFTRDGSISKSAKSNGTTTAVTSSDDETPPAVATALPAEGV
PATSTALPVGGVPATSTVLPAAPLAAQPRAAAPVTPAARAAPLPAV

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00251g169-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	159	514	3.9e-143	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.36e-20	174	514	9	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	5.30e-17	144	526	28	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA27479.1|GH5_20	0.0	1	597	1	612
CCA26601.1|GH5_20	7.89e-205	16	561	18	564
UIZ24458.1|GH5_20	3.80e-203	8	571	5	579
ABL75348.1|GH5_20	7.19e-196	14	563	14	569
ABL75347.1|GH5_20	9.08e-196	14	570	14	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ECE_A	4.21e-28	162	513	21	324	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]
1VRX_A	8.68e-27	162	513	21	324	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	2.07e-34	144	513	39	355	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.19e-26	162	513	62	365	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	2.42e-24	147	496	633	954	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|Q05332|GUNG_ACET2	3.07e-16	148	513	49	417	Endoglucanase G OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celG PE=3 SV=1
sp|P27033|GUNC_CELJU	2.18e-06	304	513	493	706	Endoglucanase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

Start	End
85	107