CAZyme Information: evm.model.AC2VRR_s00251g123-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00251g123-p1
• CAZy Family: GT66
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
619		68353.81	7.3795

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC251:228433-230345(+)

Full Sequence      

MHNKVLSIRNLSKDLLIDEQEANSRQPPVANESHPTLSGESADSRVPDATSGIISRPQTR
SKCTYTESNFLPTPLTELVCPVTPSTHILSAHLASTPGSVGRDQFPIGLRVGKDCSPKET
PRDFHGRLKRWPGILFLLVVTMAVIGGLFLGASSHYWARHRQALIASYNKQLRRKIRDSK
SDVILDVADDGQMGNPKYFPDQHCALSDYQSKGGYLVAVGPGGEETPLHIKGVNWSGMET
SLSIPLGMWENPQNGTTLYEIGAFLARNKFNAVRIPVSIENILRNSPPADGIINMATNRA
VSIRNFISTLKSIIIGLGQHGLGVLISLHRLTNMKDSGNWYDATLGISQKDYLNAVDIIS
SSLCKGRFWNVMGLDLKNEPYKATWGTGSSDDFVIGAEMIAAVMHRACPRWVGIVEGIAG
EHTLVAEGNKMQYYDWWGGGLQKAKTVRPHFGIPNKLVWGPHYYTTAVAPQPYFYGPLYA
TEGICEELDNATLKNNIESTMHDMFGYLADERDSAVLLGEFGGLYALDGHPMKTIQRTVE
YTIQIMKEQGYAGGFMWSLNPENAYEYNSCDGKGHFVEGLLKDDWLTPNTKSLAALSALD
NMPYLKRFPCYRASSTVTK

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00251g123-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	226	562	2.1e-130	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.35e-17	223	603	40	397	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.68e-12	231	563	6	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA22873.1|GH5_20	0.0	1	619	1	620
CCA19623.1|GH5_20	0.0	1	619	1	620
ABC87089.1|GH5_20	6.05e-202	111	611	70	572
ABK59036.1|GH5_20	6.05e-202	111	611	70	572
ABJ55765.1|GH5_20	7.88e-198	111	611	70	572

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	4.42e-43	215	587	16	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	4.42e-43	215	587	16	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	2.28e-42	215	587	49	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	2.28e-42	215	587	49	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	8.08e-42	215	587	49	396	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	2.54e-26	227	590	61	382	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P04956|GUNB_ACET2	4.01e-09	230	532	59	374	Endoglucanase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celB PE=3 SV=1
sp|P27033|GUNC_CELJU	2.04e-06	370	564	493	708	Endoglucanase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

Start	End
131	153