CAZyme Information: evm.model.AC2VRR_s00243g23-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00243g23-p1
• CAZy Family: GT48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		64365.50	8.6271

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC243:59661-61494(+)

Full Sequence      

MHSNDLSSPRRLESFRLPSDKVWKDTSAQECFGSYLDDNPLSGNSNQRRGPIALNASGTY
HNDITVGALGVSHASGRKEQFSGRRQTWPGALFLILMILSAAGAITYFGIQTFLRARDQH
DLSARMTGSMFKAKKITPTKVCAMPNYVTSNGKIYITYGTEEREFIVQGVNWSGMENIEG
VPHGLAYKQSNIDDIAEKLAKHKINAVRLPINAEMVITNSAPNLKSFVNMFQSPELNVPT
YMEMIQKVIQSLAKKQIAVLIDIHKVNPDYKGVTSEPLWYSAETPMAAMMKMYETLATEL
CNSLHYNVMGVDIKNEPIGGCWPKSDADVTCPEKKNWPRAVERIGNAILKKCPNWMIFAE
GLFAEKVPFKANNKNVTYSDWYGISLQNESANPIELSMSNKLVYAPHFYSPSLYPTSYFF
AEQKTNPDGSIDFVEYENTPAGDAALQNAIKTVLNTAFGGILKEKKVPVLFGEFGGIYGL
KETLPGKTSTRSLDYVMQYAKQFGMVGGFLWAVNPDGEYTFNAAYTPKNVIRYGAYKDSD
WKDVHEDLMKALQNLRGSGPVPCFTSSNKKSNLTRVAI

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00243g23-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	162	517	1.7e-143	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.32e-18	177	517	9	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	1.55e-18	147	515	28	361	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA26601.1|GH5_20	0.0	1	578	1	578
CCA27479.1|GH5_20	1.27e-218	12	576	9	587
ABL75347.1|GH5_20	4.32e-194	22	565	20	567
ABL75348.1|GH5_20	6.86e-194	22	565	20	568
UIZ24458.1|GH5_20	5.92e-192	22	567	17	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZUM_A	1.15e-30	154	575	51	424	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.56e-30	154	575	51	424	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3W6M_A	1.61e-30	154	555	18	375	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	2.98e-30	154	555	18	375	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHO_A	5.24e-30	154	575	51	424	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	3.92e-29	147	516	39	355	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	8.16e-27	167	516	64	365	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	2.03e-24	169	543	649	1000	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000043

TMHMM  Annotations     

Start	End
88	110