CAZyme Information: evm.model.AC2VRR_s00227g103-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00227g103-p1
• CAZy Family: GT33
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702		77418.46	5.5164

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC227:213966-216074(-)

Full Sequence      

MDGEKVNQANLLKLAQLGIGSYLNNFGVFNRNGFQENLNGSEIRQIIDNMMDVSLKEDPN
NPILYGLDSVHGANFVGKATIFPAQINIGSTFDVKYAFQVGVVASNDTAGAGSKYVFGPV
ADVALSKRSCRIQETFGQDSYLVSRMTAESVKGIQNNGLVTACLKHFLGYQHNYLGYDRV
NVEISDFNLVNTILKPFIAGIDAGALSIMQSYSSVNTLPMVDNAEWLHTVLRDILHFKGV
VITDYKEGQNLVDFHHTAENYTDALKRCIKAGVDISMVVDLSINWIEILKQILKEDPSMA
PYVEAAVKRVIYVKNQLNLYDQPYSGKELLANIGSQESIDLAIQVARDSIVLLRNNDSVL
PLNPNSKILVTGNAANNAGGMSGGWSHVWQGQDGNDLFKERITILDGLKKLAQRLTYTVG
LNYTQEYDEQEVLKAQNMAKDADVCVVALAEHSGVEKPFDIDDLALPLNQTKFLDAMKMS
CKKLVLVLVQARPRTFPVTSDIHAILNTMLVGPHGGQAIAEILMGLYNPNGRQVVPYSMK
DGHDSLVYNAPVDTLCGYGPCVADFPFGFGLSYTKYVYSNLRMSTQTVACAGTLTVKVDV
SNQGSMAGREAVLLFIQQKTRSHVPEIKNLKSFEKISLAIGETKTVTFELQQDAWTYLSP
KIEENFRVVCEPGAFFVAIKYDTLCKFDGEETNEMCGRFTVV

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	278	1e-54	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.37e-99	42	683	88	754	beta-glucosidase BglX.
224389	BglX	2.82e-58	13	410	6	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.89e-46	64	669	91	759	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.57e-42	14	311	27	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.34e-37	350	573	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA21377.1|GH3	0.0	1	702	54	755
CCA21376.1|GH3	0.0	1	702	54	755
CCA27737.1|GH3	7.70e-163	6	701	99	808
UIZ29009.1|GH3	1.51e-159	2	701	58	762
UIZ27116.1|GH3	2.60e-153	6	701	16	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.91e-101	45	651	87	715	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
6R5I_A	5.00e-73	62	683	73	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.54e-72	62	683	73	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	2.59e-72	62	683	74	723	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	4.43e-72	62	683	105	754	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.03e-101	19	679	126	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.35e-100	45	651	109	737	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	3.67e-79	42	683	88	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	9.63e-77	42	690	88	761	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	8.29e-75	65	679	70	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00227g103-p1.