CAZyme Information: evm.model.AC2VRR_s00201g34-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00201g34-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	Acan2VRR_SC201|CGC2	73339.20	6.3721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC201:111256-113190(-)

Full Sequence      

MRHTHGVMLKCVCLQMILNPLPVLSERFQQMQVTTSDSRSVTSEYTLSSTKGLNEAKWRW
EHEDSAVQNEESLFKTFIPKDESKTCSPIGNDATSFNMQIRGVNLGGLFVLEPWITPTLF
YQFLGTPERFGNKAPEKTALDTFTFCTALGKKEANLQLRIHWAYWLTEDDFIRLHAAGVN
SVRIPVGDYMFVPYEPYIGCTDGAVEVLDQVLDWAHKYGMTVLLDIHTQIDSQNGFDNSG
KTSNVKWKETHGTKPNESVAFEHWPHRVAEWIGPYDANTKTYLSINYANLLHSLDVVTAI
VERYATHPAVMGLQPINEPWEYTPIPILKEFYWKGYKRVKAVAPNWNFVIHDSFRFTTDI
WADFMRGCPGIALDTHMYQAWIKPGTQADFFSNACQQKQTIFNMEKKGMPVIIGEWSLAT
DNCAMWLNGFNDNMVGYPKVQCAFIKCPVTSTYLGNGFPGTPLDRSKPMQGPYGLNPSGP
SFGLCPITSNTAFHQVDDKQLTLDLLRKRLNAWSAGHGWYFWNFKTELDYKWSFLDLYDR
GFMPKNISDYGNVKDILSACDKEDKGEFYCHANATVKDVELEKGLSYACSSPKIDCSKLS
TKYPTILERCDVAYNEYWHQHRREGATCDFDGTAYLSELNAPGK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	157	434	1.2e-144	0.9964028776978417

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.19e-28	84	550	2	388	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
197867	X8	6.88e-14	569	640	2	77	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
400371	X8	1.02e-10	568	635	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
395098	Cellulase	4.48e-06	152	437	6	263	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA22662.1|CBM43|GH5_33	0.0	31	641	1	611
CCA26577.1|CBM43|GH5_33	0.0	53	641	28	615
BAS04784.1|CBM43|GH5_33	1.95e-293	53	644	63	655
UIZ22001.1|CBM43|GH5_33	1.40e-290	46	640	12	606
AAM18483.1|CBM43|GH5_33	5.27e-284	50	643	81	672

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	5.71e-47	97	549	6	384	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	1.25e-46	97	549	12	390	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	2.07e-46	97	549	6	384	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.37e-46	97	549	12	390	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	4.41e-46	97	549	11	389	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	4.16e-58	97	547	34	407	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	7.59e-49	100	549	42	408	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|D4AJL7|EXG1_ARTBC	1.30e-47	100	547	34	403	Probable glucan 1,3-beta-glucosidase ARB_04467 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04467 PE=1 SV=1
sp|A1CRV0|EXGA_ASPCL	1.36e-47	92	552	33	412	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q8NKF9|EXG_CANOL	3.23e-47	97	549	34	416	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.262638	0.737341	CS pos: 25-26. Pr: 0.6932

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00201g34-p1.