CAZyme Information: evm.model.AC2VRR_s00189g288-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00189g288-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		62632.47	6.6126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC189:554974-556650(+)

Full Sequence      

MKLQCVLLFASVLTAFCRVVVFDWNVTRILASFDGVQRSVIGINGRPSGEAIIQVDLGDW
IQVNTHNSLNESICLHWHGILQRGTPEMDGLSGITQCAIRPKRTAIYNFTSEFPGTYWWH
SHEKAQYVDGLRGALIIHNTSPWKQKIDGEYILQLTDWYHTESILLIANATNVSINPRGD
KPVWNTVLINERGQFNCSQRDPTLFPVCNTTQPLTAIQFLPGHLYRLRLINQAGFASFNF
SIDQHLFQVIEIDGFPVQPSKPINSLAVNIGQRYDILIHANGSIHDRFWIRAKSLFGSPF
TSLPLNQFPNGFNPNGLAILEYSATKCDFSMIEPTSTEWNSILTVSSDLDFIPMTREILP
TNPQERMTVEFTLAALQGDPVTRGYASINQSPYETFLVPPTPTLFDIANGKTAFPTTLNP
FVFVPHRHTEIVILNNSPAEHPFHLHGHTPYVLGSGLIDVNASNRSQPIPSSSLNLLNPI
RRDVFTLPACTFNATNGCLDRGYVVLRLQTDNPGTWILHCHIEWHLETGMAMLFIEDTPA
LMHRGIREFGTSMLQTCA

Enzyme Prediction     

EC	1.10.3.2:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	36	531	2.4e-93	0.9804469273743017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	3.47e-78	22	536	4	523	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	6.95e-69	6	536	8	546	L-ascorbate oxidase
215324	PLN02604	2.67e-67	5	536	8	546	oxidoreductase
274556	laccase	2.56e-54	25	537	14	520	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.
225043	SufI	1.26e-51	20	539	34	451	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26495.1|AA1	7.21e-151	15	558	19	562
AFY09915.1|AA1	1.61e-144	19	554	21	561
AFY09916.1|AA1	5.24e-140	10	557	16	544
UIZ26488.1|AA1	3.02e-137	14	557	11	536
AIG56347.1|AA1_2	5.00e-95	18	558	40	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1V10_A	1.08e-67	20	539	24	492	Chain A, Laccase [Rigidoporus microporus]
3V9E_A	1.56e-64	34	558	82	562	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
1ZPU_A	1.59e-64	22	557	5	500	Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_B Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_C Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_D Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_E Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae],1ZPU_F Crystal Structure of Fet3p, a Multicopper Oxidase that Functions in Iron Import [Saccharomyces cerevisiae]
3SQR_A	4.21e-64	34	558	82	562	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
5LDU_A	7.87e-62	21	539	5	472	Recombinant high-redox potential laccase from Basidiomycete Trametes hirsuta [Trametes hirsuta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9R598|FETC_ASPFU	1.00e-75	11	536	14	492	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1
sp|K7NCS2|FETC_EPIFE	7.99e-73	10	536	13	495	Iron transport multicopper oxidase fetC OS=Epichloe festucae (strain E2368) OX=696363 GN=fetC PE=2 SV=1
sp|Q09920|FIO1_SCHPO	2.24e-71	22	536	27	497	Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fio1 PE=3 SV=1
sp|A0A067XMP2|PTAK_PESFW	1.56e-68	22	536	67	548	Oxydoreductase ptaK OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=ptaK PE=2 SV=2
sp|I1RMG9|FET3_GIBZE	9.06e-68	22	558	27	516	Iron transport multicopper oxidase FET3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FET3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.436484	0.563498	CS pos: 17-18. Pr: 0.5362

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00189g288-p1.