CAZyme Information: evm.model.AC2VRR_s00185g61-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00185g61-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		53843.52	8.8924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC185:138272-139980(+)

Full Sequence      

MELDEIQRICLEHLRAPEKRLAQKVLADNVMRMIHGMDGLEKAKRATNALFSENISHLQS
SELHQLVQDAPVHIKRYEEIVKQQLVDLMAATGICRSKAEARRLILAGGVYVNNIRVKAV
DYVIESDVIIDTGFMLIRTGKRNSHILKAEYDYIIIGGGSAGCVLANRLTEDGQNKVLLV
EAGLSDMHQWDSWKIHMPAALTYNLANDKYNWCYNTQAQRHLNNRRLSWPRGRVLGGSSS
LNAMVYIRGNANDYNDWEKSGAIGWSYADCLPYFRKSQSHSLGANAYRGGSGPLHVTRGN
QKNQILFQKFIDAAMQAGYPFTDDMNGYQQEGFGWMDMTIHKGCRWSASQAYLWPAIKRP
NLKVITNTMTTKIEFQGHRATGINVECNRTRRQTKIRANKEIILSGGAINSPQLLLLSGV
GDADHLKQVDVPLVHHVPAVGKNLEDHLDLYVQYECTQPITLHHATWYEFNRLVLF

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00185g61-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	150	463	5.9e-107	0.5704225352112676

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	150	463	5	315	choline dehydrogenase; Validated
225186	BetA	4.04e-116	148	468	5	324	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	6.09e-60	151	449	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
235645	PRK05912	1.96e-29	1	148	275	407	tyrosyl-tRNA synthetase; Validated
237360	PRK13354	2.56e-25	1	143	273	403	tyrosyl-tRNA synthetase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	3.29e-175	147	474	24	351
ANI26486.1|AA3_2	3.98e-144	150	465	70	385
AWP09430.1|AA3_2	8.47e-142	138	465	9	334
CAB3230510.1|AA3_2	1.20e-131	148	465	22	339
CEF60566.1|AA3_2	4.53e-122	142	470	24	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NCC_A	2.16e-52	143	446	16	321	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS1_AAA	2.31e-52	144	446	1	305	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.31e-52	144	446	1	305	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	2.31e-52	144	446	1	305	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	4.44e-52	150	446	7	305	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	3.81e-141	148	465	43	360	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.78e-138	148	465	40	357	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	2.41e-135	148	465	38	355	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|A4XPI5|BETA_PSEMY	1.09e-104	147	465	1	319	Oxygen-dependent choline dehydrogenase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=betA PE=3 SV=1
sp|A8GBX9|BETA_SERP5	1.16e-104	150	469	2	322	Oxygen-dependent choline dehydrogenase OS=Serratia proteamaculans (strain 568) OX=399741 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00185g61-p1.