CAZyme Information: evm.model.AC2VRR_s00168g117-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00168g117-p1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
738		82035.52	5.2955

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC168:241896-244112(-)

Full Sequence      

MKNAISCLSFALAVCKDSRVFAQEMNATGDAGLPPMSLIKSTDAMQSLVPPKFVDPNIRQ
KRAIPTNAWWANLIAYDKSNVVQPAWSNPFSISIIIDRAPFGIALNYPYARRFTGGSSGN
NGAVKFYSHGLVKDAIFGAIEFSGQPKFLVTDWSDLGCTLELSTSSDCKIVSDILSGMAY
GTYRYTNLTPKLTMSTAIISLNGEGPGTVTTSRLEISLNNGQKWIVYSLSSEGTVEEPIT
WTCEDGTNVRASSVFNGIIRASLLVGENGNPEVSAALDRYRTCIPISGTVDIPDDTSYSL
EYKTMGDCGGGLLHYGQQHHVDSIDMSSITAVTGMTSNSATRGPMQALATNCREDSCQWK
FFETQETATDIFPPRGVSTSLTSQHRLMEKLRQDIEAQWSVPLGGSYYFNGKLVQKYASL
CIVASDENVVGSDSALLQTCLGKLREVMQPYLTNSWTNELVYDVIYGGIVSSEGFKRKDA
GADFGNSMYNDHHFHFGYWLYTSAIIIQLDPKWERIDELKTMSNLLAYDVANCVANDANY
PRFRNFDWFRGHSYSHGATSLGDGKDQESSSEDINFSFGLYLYGKASANPLFERIGRVMT
RLNTRAVKMYFLMQDGNTIHPSNFIANKVTGIIFDNKADYATWFSPEKYSIHGIQMLPVS
PQTELVRTKPFVQQEWEQVLSREPIVRNENIDNTWLSLLYLNYAQLDPNRAMEVLERAAM
DDGLTRTWALYMSASYAV

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00168g117-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	51	731	1.9e-179	0.9871382636655949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.10e-143	391	730	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	4.78e-132	43	738	71	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.46e-46	49	374	3	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25006.1|GH81	0.0	1	738	1	738
UIZ20868.1|GH81	1.36e-286	34	737	90	793
UIZ20872.1|GH81	2.73e-286	34	737	90	793
UIZ20875.1|GH81	2.73e-286	34	737	90	793
UIZ20873.1|GH81	1.10e-285	34	737	90	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.31e-110	57	735	34	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.51e-109	57	735	59	742	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.12e-103	57	735	34	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.26e-27	490	723	414	643	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.02e-20	396	724	349	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.21e-88	64	737	226	904	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.17e-87	64	734	35	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.49e-81	34	737	79	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.73e-78	30	734	433	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.25e-76	64	737	434	1113	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007663	0.992289	CS pos: 22-23. Pr: 0.8521

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00168g117-p1.