CAZyme Information: evm.model.AC2VRR_s00167g103-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00167g103-p1
• CAZy Family: GH7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	Acan2VRR_SC167|CGC1	86022.76	7.0378

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC167:176664-178910(-)

Full Sequence      

MRLDVICFSKDRVFQLSEYLRTFHKHVFYRGKAINEWHPSHRSEGNAKRDEVRILMSVIC
KCSTPEMKRKYERLAMNYATVNFMFEDESEQRSFSSHLLDIFDQKNATDGGLGSFVWFNV
DDAFFFDRIDVDHFLPYFFCSQKTSKWHFAFHIKLSPNVWRSHMTNEHMLPLPHFEPFTA
RISNDGMSNAQNVLLTFNPAQGRVDWNYPWDLSGSVYTSSSVDFIVQGILEKHGRNGINH
PNVLELHGNQYLKDSGKIETVQCGCLSRAAMHLLAVNQVQDVFKNPLYTMQLITKEGTSC
TPSTSKDLEQYYEAGYIFNELYYKTDRFPSVHIGQLSLIADGPDPCPTKAQPLVSIVIPA
YNAEHYVEEAMRSIMNQTYRNLEIFVIDDASTDSTRHIIENLMTEDNRIHYYRNSRNLGV
AAALNIGFMKAKGAYIARMDADDISMSERIARQVLFLEKNLYIDILGTSIMTFGQSNMSS
TDGQSHHSADNTLGRIIIHSLSPIITQWQMLFGCHFAHPTALIRRSVVDRIISKTGQKVI
YNESWSCCEDYDLWLRCLYDHQFVMASLGDVLLLHRKHARNISKIQRARQKDEADDIIGK
YLPRWIGVHVRREIIQMLRASTTGNEQNDSEIIQTSVGFDEAIRIIHKLGDYFLSICDAQ
FRTIPSEELQSALSYICQDVVAREGMLALQAFTTGDFTGAARMWISYCKRNEREGRTAFC
KLLDNTKKARQKDEGVHLSSYIYKSTDL

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00167g103-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT74	2	331	1.4e-98	0.9964285714285714
GT2	355	529	1.1e-36	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395426	Glycos_transf_2	2.33e-37	355	528	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133055	GT_2_WfgS_like	2.49e-33	355	564	1	183	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
132997	Glyco_tranf_GTA_type	2.34e-32	356	468	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
223539	WcaA	4.55e-27	351	445	2	96	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
133039	GT_2_like_d	1.57e-24	355	583	1	210	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA24176.1|GT2|GT74	0.0	1	726	1	730
CCA24092.1|GT74	1.75e-69	64	345	87	332
QKJ69427.1|GT2	4.05e-45	352	643	5	260
AGM38788.1|GT2	7.03e-44	352	643	5	260
AGM38751.1|GT2	2.49e-43	352	643	5	260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	4.19e-15	349	464	10	124	Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5HEA_A	1.23e-14	353	443	6	95	CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
2Z87_A	1.13e-12	349	556	371	553	Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	1.14e-12	349	556	372	554	Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
1H7L_A	1.20e-11	352	536	1	176	dTDP-MAGNESIUM COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QG0|PGFB_DICDI	3.34e-34	3	336	470	766	Bifunctional glycosyltransferase pgtA OS=Dictyostelium discoideum OX=44689 GN=pgtA PE=1 SV=1
sp|Q57287|Y1578_HAEIN	8.85e-30	352	611	5	253	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
sp|Q57022|Y868_HAEIN	8.76e-23	352	558	4	183	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
sp|P71054|EPSE_BACSU	1.31e-21	352	556	5	188	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
sp|Q58457|Y1057_METJA	4.55e-20	351	589	7	227	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00167g103-p1.