CAZyme Information: evm.model.AC2VRR_s00143g21-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00143g21-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472		54130.18	5.5444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC143:39986-41455(-)

Full Sequence      

MEAVLDQYAHIYPKSSNLNISAHENKSYVQFSWEIDSFEPISTKNQKVNSTSDLLLMANP
HQLMTFSEVHISSNVFQVFDIETGYRTLKSNMTAVVGKTWVLEENLTDIGFGSHQDIQLE
SIPLHKEAIRESLYNDSKFVPQAQDPYFFGKEVNRQAKLALIANTLGERSVRDDILDQLQ
VWMTTWLTGSNSDPFVYDTIWGGICSKNGLNGIFWMTDFGNGWYNDHHFHYGYYLNTLAI
ILKFRPLYFKQHEAAILSLVRDIANPEQNDPYFPFTRHFSWFDGHSFASGVYTLDGGKSQ
ESVSEAINAYYGVYLLGLALNMTSLRVMGQVLLGMESRAAQVYWQMPSWSTIYEPEYAAN
KMSGQIACTKVQYSTWFGPKPEHMHLINMIPFTPASNLFLKRRYIAEEYQVLLDQALRRP
NYSVEELWKGYAILALALLDPSAAWDQLQQIQTFDDGNSRTSSLYWIAVQKP

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00143g21-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	3	466	6.9e-137	0.6961414790996785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.89e-93	126	464	7	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.04e-72	2	464	294	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	6.86e-09	1	111	217	316	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19047.1|GH81	3.45e-309	1	470	346	815
CAN97272.1|GH81	2.05e-93	3	470	279	717
AGP40408.1|GH81	1.64e-91	3	470	263	701
AUX36386.1|GH81	2.10e-91	2	470	273	712
UQA58532.1|CBM6|GH81	5.96e-91	4	470	483	920

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.11e-50	2	470	256	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.57e-50	2	470	281	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.36e-48	2	470	256	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.13e-38	141	467	334	653	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.11e-26	1	460	231	674	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.65e-53	46	468	469	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	8.46e-50	55	464	355	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	5.25e-46	2	464	644	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.67e-44	49	468	711	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.15e-44	2	468	279	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00143g21-p1.