CAZyme Information: evm.model.AC2VRR_s00141g37-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00141g37-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	Acan2VRR_SC141|CGC1	59585.26	7.1116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC141:77438-79437(-)

Full Sequence      

MGKNKIKKKSKIKPFVKYVNYNHMMPTRYIVDIDLKKVLDDDVMSKPESRVETRKTIKKV
FEERLLLFANGISALTLDHLTWNLTSDTFFLTQPLFDIGRIVISDVFPEPSIPPKQLWEI
AKQYTPNSRGFVLPLFDGNSHLGFSLLIDFERKFGLKIPVEVPHCGDLEIEIQEQLKVRF
PSIRIFDVCDLAALAEYNGQKIFCQHVNHCHEIFRSFLIGVLAVVYSTFDEIMLLDADTQ
YFTDPTETWELEDVKQTGVLLFRDRVVEPYKFLLEPTEEEHQGLRRLHRFLGAFDPRPYR
FLGHVASEPAPDEWVATMSSESFRHYKPSKLAMTTHAWNFLSGHNIDSSFVLWSKGKQSR
ATTILASFVSLNGVPSPPSYGDKELFFFACELAETSYAVSKYGAGSITSNEPILNNTALC
GDALHFLPIRQPSQNWSLSANDGVPFYTNGDYISSWDPEHDKLFHTMSTPANFHLNVLKR
SKTHVGCLQRRVVVNASEAMRNAISERIKALRELQFGFIGR

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00141g37-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	129	421	1.2e-40	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396371	Ribosomal_L27e	2.63e-21	14	64	19	70	Ribosomal L27e protein family. The N-terminal region of the eukaryotic ribosomal L27 has the KOW motif. C-terminal region is represented by this family.
402574	Mannosyl_trans3	3.53e-13	128	421	1	266	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
240428	PTZ00471	9.61e-09	15	64	71	119	60S ribosomal protein L27; Provisional
240514	KOW_RPL27	4.06e-08	14	32	65	83	KOW motif of eukaryotic Ribosomal Protein L27. RPL27e has a KOW motif at its N terminal. KOW domain is known as an RNA-binding motif that is shared so far among some families of ribosomal proteins, the essential bacterial transcriptional elongation factor NusG, the eukaryotic chromatin elongation factor Spt5, the higher eukaryotic KIN17 proteins and Mtr4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA24247.1|GT71	1.42e-272	65	520	15	470
UIZ28847.1|GT71	1.79e-87	116	474	25	388
UIZ29125.1|GT71	2.48e-76	123	468	106	450
UIZ29124.1|GT71	1.49e-65	123	514	138	523
UIZ29140.1|GT71	5.58e-50	123	509	142	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OLC_LZ	1.17e-15	1	64	56	120	Chain LZ, 60S ribosomal protein L27 [Thermochaetoides thermophila DSM 1495],7OLD_LZ Chain LZ, 60S ribosomal protein L27 [Thermochaetoides thermophila DSM 1495]
5IT7_ZZ	3.45e-14	2	64	56	119	Chain ZZ, KLLA0E03455p [Kluyveromyces lactis]
6WOO_Z	3.45e-14	2	64	56	119	Chain Z, eL27 [Saccharomyces cerevisiae]
4U3M_N7	3.53e-14	2	64	57	120	Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U3M_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U3N_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U3N_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U3U_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U3U_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4N_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4N_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4O_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4O_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4Q_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4Q_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4R_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4R_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4U_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4U_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4Y_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4Y_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4Z_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U4Z_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U50_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U50_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U51_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U51_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U52_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U52_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U53_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U53_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U55_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U55_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U56_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U56_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U6F_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4U6F_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],4V8Y_BZ Chain BZ, 60S RIBOSOMAL PROTEIN L27-A [Saccharomyces cerevisiae],4V8Z_BZ Chain BZ, 60S RIBOSOMAL PROTEIN L27-A [Saccharomyces cerevisiae],5DAT_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DAT_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DC3_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DC3_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DGE_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DGE_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DGF_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DGF_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DGV_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5DGV_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5FCI_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5FCI_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5FCJ_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5FCJ_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5I4L_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5I4L_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5LYB_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5LYB_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5M1J_Z5 Chain Z5, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5MEI_AA Chain AA, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5MEI_DB Chain DB, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5NDG_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5NDG_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5NDV_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5NDV_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5NDW_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5NDW_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5OBM_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5OBM_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5ON6_AA Chain AA, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5ON6_DB Chain DB, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5TBW_AA Chain AA, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5TBW_DB Chain DB, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],5TGA_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5TGA_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5TGM_N7 Chain N7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],5TGM_n7 Chain n7, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],6GQ1_Z Chain Z, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],6GQB_Z Chain Z, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],6GQV_Z Chain Z, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],6I7O_AN Chain AN, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],6I7O_XN Chain XN, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],6OIG_Z Subunit joining exposes nascent pre-40S rRNA for processing and quality control [Saccharomyces cerevisiae],6Q8Y_AN Chain AN, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],6R84_b Yeast Vms1 (Q295L)-60S ribosomal subunit complex (pre-state with Arb1) [Saccharomyces cerevisiae],6R86_b Yeast Vms1-60S ribosomal subunit complex (post-state) [Saccharomyces cerevisiae],6R87_b Yeast Vms1 (Q295L)-60S ribosomal subunit complex (pre-state without Arb1) [Saccharomyces cerevisiae],6S47_Ab Chain Ab, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],6T4Q_LZ Chain LZ, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],6T7T_LZ Chain LZ, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],6TB3_AN Chain AN, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],6TNU_AN Chain AN, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],7B7D_LV Chain LV, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],7MPI_AZ Chain AZ, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],7MPJ_AZ Chain AZ, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],7N8B_AZ Chain AZ, 60S ribosomal protein L27-A [Saccharomyces cerevisiae],7NRC_Lb Chain Lb, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],7NRD_Lb Chain Lb, 60S ribosomal protein L27-A [Saccharomyces cerevisiae S288C],7OSA_eL27 Chain eL27, 60S ribosomal protein L27 [Saccharomyces cerevisiae]
6UZ7_AZ	3.62e-14	2	64	58	121	Chain AZ, KLLA0E03455p [Kluyveromyces lactis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14388|RL27A_SCHPO	1.00e-13	1	74	57	128	60S ribosomal protein L27-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpl2701 PE=2 SV=2
sp|P0C2H7|RL27B_YEAST	1.86e-13	2	64	58	121	60S ribosomal protein L27-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL27B PE=1 SV=1
sp|P0C2H6|RL27A_YEAST	1.86e-13	2	64	58	121	60S ribosomal protein L27-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL27A PE=1 SV=1
sp|Q9P843|RL27_CANAX	8.77e-13	1	64	57	121	60S ribosomal protein L27 OS=Candida albicans OX=5476 GN=RPL27 PE=2 SV=1
sp|O74538|RL27B_SCHPO	1.63e-12	1	64	57	121	60S ribosomal protein L27-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpl2702 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00141g37-p1.