CAZyme Information: evm.model.AC2VRR_s00137g108-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00137g108-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	Acan2VRR_SC137|CGC1	42060.79	6.4971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC137:205204-206301(+)

Full Sequence      

MSFQLDIREGRIPCRGVNLGGWLVVEHWITWDAPLWKDVPSDIIDSGEFALMKHLGHEEG
DRRFHHHRSTWITVDDIKEIKQRGLNTVRVPVGFFILGYDSGNAGHLKEYAVFAPNSLYF
LDQLINVWCIKHEIAVIVDIHAARGSQNGMEHSAPPTPGVCYWSEYPENIDDTVIVAQFL
CSRYRNSPAFLGLGMLNEPNYPVDPEKTKEYYLRVYKEIRSTGDDCILLVSPMLSEQGPP
HLESFMVSGENYINVWVDWHPYFIWGYEKCSSEEILKAVKQYGKTVDKWKGNRLFFGEWS
LGAPQCIGSDRTKLKEFANAQMKAFSNRKTTAGWTFWTWKHSSDSSSDLCGWSMRQLLRQ
EVLHF

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00137g108-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	345	1.3e-46	0.9747292418772563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.43e-21	15	355	19	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	5.00e-11	75	339	28	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15861.1|GH5	1.25e-240	1	364	10	373
UIZ29723.1|GH5	1.44e-161	7	363	5	360
AAM18484.1|GH5	1.84e-156	2	363	8	368
CCA15900.1|GH5	2.53e-116	4	363	103	452
UIZ29004.1|GH5	2.12e-112	4	361	38	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	6.54e-33	15	340	10	360	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	2.40e-32	15	340	10	360	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	2.60e-32	15	340	15	365	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	2.64e-32	15	340	16	366	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	3.65e-32	15	340	16	366	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	3.17e-36	4	343	27	388	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	4.28e-36	15	362	30	389	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q12626|EXG_PICAN	1.84e-34	16	358	51	414	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|B8N151|EXGA_ASPFN	2.18e-34	15	362	32	391	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	2.18e-34	15	362	32	391	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00137g108-p1.