CAZyme Information: evm.model.AC2VRR_s00137g107-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00137g107-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	Acan2VRR_SC137|CGC2	42727.56	6.6532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC137:201398-202510(+)

Full Sequence      

MSFQLDIREGRIPCRGVNLGGWLVAEHWITWDAPLWKDIPSEIIGKGEFALMQHLGHEEG
DLRFHNHRSTWITVDDIKEIKQRGLNTVRVPVGFWIIGYDPADDTNSKQCEAFAPNSLCF
LDLLINDWCLRYKIAVIVDIHAAKGSQNGMEHSTPREYGKCCWSESPENVKNTLHVSQML
CSRYRFSPAFLGLGLLNAPTHPLDPTKAKDYYRRAYHAIRSSGNDCILTVSSVLLEQRQA
HFHDIVDPLDSKDDYFNVWVDWHPYYAWGFNKCVESEITAAVEECEKIVRRWKGNQLIFG
EWSLGAPQCIGIDREKLQRFAEAQIKAFNNRRNSAGWIFWTWKHSSDAQVDLCPWSMRQL
LREEILHVPA

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00137g107-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	65	347	4.3e-44	0.9711191335740073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	9.01e-18	15	349	19	369	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.60e-09	75	342	28	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15861.1|GH5	1.22e-195	1	370	10	376
UIZ29723.1|GH5	2.74e-141	7	366	5	360
AAM18484.1|GH5	1.93e-140	2	368	8	370
CCA15900.1|GH5	2.70e-106	4	368	103	454
UIZ29004.1|GH5	3.90e-95	4	364	38	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.67e-32	15	370	10	382	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.34e-31	15	370	10	382	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.47e-31	15	370	16	388	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	1.47e-31	15	370	16	388	Chain A, Hypothetical protein XOG1 [Candida albicans]
3O6A_A	2.00e-31	15	370	15	387	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12626|EXG_PICAN	8.12e-40	16	369	51	422	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|Q96V64|EXG_BLUGR	1.87e-38	4	369	27	406	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q12628|EXG_KLULA	7.03e-35	15	369	37	415	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	9.13e-35	15	361	32	387	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|B8N151|EXGA_ASPFN	9.13e-35	15	361	32	387	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000075	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00137g107-p1.