CAZyme Information: evm.model.AC2VRR_s00095g26-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00095g26-p1
• CAZy Family: GH37
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
152	Acan2VRR_SC095|CGC1	15946.31	7.2103

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC095:85370-85877(-)

Full Sequence      

MPGLGIVGTPLLSALQQLVPGTEGYAVMYPATADFFTSAAVGTADAVRHIQSRAVQCPNT
MFALGGYSQGAMVIHGMKLDPTLQQRSIGIASFGDPFRAMNAQWPVSSPNKIFSFCALGD
PVCQNGFNGMAHMTYTQNVAAAAQSLVGPYLT

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00095g26-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	2	143	3.5e-33	0.8677248677248677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.77e-28	2	147	17	169	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA23745.1|CE5	5.74e-67	1	150	38	187
CCA23744.1|CE5	1.35e-37	1	142	143	280
CDR88973.1|CE5	2.47e-32	4	150	186	324
CDI56684.1|CE5	4.98e-32	4	150	39	177
QRW25500.1|CE5	1.22e-31	3	138	43	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.03e-13	11	147	108	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1QOZ_A	3.59e-07	11	152	25	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
5X88_A	5.88e-06	56	146	100	194	Chain A, cutinase [Malbranchea cinnamomea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P9WP43|CULP1_MYCTU	1.03e-22	3	138	51	199	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1
sp|P63880|CULP1_MYCBO	1.03e-22	3	138	51	199	Carboxylesterase Culp1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2006C PE=3 SV=1
sp|P9WP42|CULP1_MYCTO	1.03e-22	3	138	51	199	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1
sp|C8VJF5|CUTI4_EMENI	1.04e-19	6	147	80	218	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|A8QPD8|CUTI1_TRIHA	2.57e-15	6	143	99	240	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00095g26-p1.