CAZyme Information: evm.model.AC2VRR_s00077g19-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00077g19-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2238	Acan2VRR_SC077|CGC1	254179.04	7.8040

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

Full Sequence      

MSQPTHYRESSRRRASSNYFELDADRRRTKSGRKDRLSHRVMSLEAAETIPGDKFSTAPQ
NIVNSTAVLDDDEISIDYCCDFLYAKFGFQEGSVANQREHVLLLLANGKARHHPSQPSHH
HITQLHAKLVSNYKSWCEFLKTNPIHYQGVISGNLRHPLHMEIMLFFLIWGESSNLRHMP
ECICYIFHQLMKHLNQDIQGQDGKKEGWFLENVVQPIWEECSNMKRRNHLNKPLEHVKVR
NYDDINEYFWKPYCLKIEVTQVGHELAQKHGKTFYEHRSIFTLILNYYRIFQANILFLTI
LVVLAFAVSISPNGGRSGFSQFQALGKTIEPFEKRDLKIGFVVLPFVMSLLGICKCVLEF
AHSFHIIFSSESSLTSSRSWPYTLALAARTLWHTGFMALFAFMIYIPLRDQSDTTLLQNA
YAVMAVYIIPGVAILAAQTFYPNLIRKTFALKFVREGSSSYVGREMAPPWKYKVQYVLFW
IVLWICKSVVSYTILVRPLMLPSLAVYEMRLTYQSSVASFHNILVLVSYWAPTVLIFNYD
TQIYFTILQSIIGGYMGWRMKTGEIRGSKELTRAFRVAPQLFDQKIVTNLARSSDLAQSL
NPKDSKTSVNAATYESQMMLRFVVVWNEIVNSFREGDLLDDKEAAILQYDIRSNGEVFEP
VFLSAGKLGEAITKTIRNSKDGKSESQLQVSLVEGDCVSAIKSFFTACMYVMEALFGMED
GNVIDGLRMMEEVVENRASMRSFQFQELARLRLAALDILEEILDLPDPSTVSAHLPDTFI
HTLGIIRNFVNKMEVLLNSLQAFSEAPELKGKFVNTKFCSSPNGYMYAAQGLVNLYRSDV
AMGAATRACLLLSLDRSEAMPRCMEAQRRLGFFMRSLVMEIPQLNAIKEMRSFSVVTPFY
AETVLFSLKELNDPLVNHPIFQKVEEGGKNLTILKYLNKIHPEEWENFLERVDVASAEEA
QERYPQEIRLWASYRGQTLARTVQGMMLYEDAIKILHWLEIGSNSARTAEEKQTQLQDMV
RLKFSYICACQVYGKHRRENKQQADDIDYLLQEYPNLRVAYVDTIESGENQYMYDTVLIK
SEQNEIVEVYRYQLPGDPIIGEGKPENQNNAMQFTRGEFVQTIDMNQQHYFEECLKMPQL
LRTAELHSSGKPVSIIGMREHIFTGNASSLAKFKTWQELVFVTLSQRVLADPLYVRMHYG
HPDIFDKVLALTRGGVSKSSKGINLSEDVFAGFNATLRGGVVTHVEFMQCGKGRDVALSQ
ISMFEGKLANGAGETSLAREAHRMGQFMDFFRLNSMYYSHTGFFFATWMTVVTTFVYMYC
KVYIALVGVQDQIIYKMNETSILSQNERYGIPSRAYYDTNAIVNTQYYIQAGLFLSLPLV
VVYFSEMGLYRGFFRLIEMVITGGPFFFIFQVGTTMHYFDNNLVHGEAQYKATGRGFKIT
RELFVLLYKAYASSHYRKAFELTGLCLIYLTYGDFNICGPPPTADGNSFSFDFCTTAQSF
WVQTFAIWFIAITWFIAPYIFNTDGLDFQKTKADIQAWATWMYADEKYEDEDSTMNGGWI
GWWKSELKLFHNSKPIARLTIVLRESRHFVLMWYVVTLKWDLLTIAYVLGAGVLSVLLLN
VMCLLRLAFRRCRPIPRALIYVTTVCLAIAAYFAITKYLFSTDFQEAASLFYGYIAVLYG
INEMARMYSFQSTSIANTTIFQELAFFFDFMICFIMIVPLFIMSGIPFLNIVQTRMMYNK
GFSQIVSASSQYAFSLAAFLGVVGGSGCGWILYVMSVLESSPGFISYATNYDLLDNKAGD
GTTTYYFYFAAVMAAVLGGFFNFFFGRRLTVVCGGMLSALAMVLISAVTTQGESLLFPGT
ALLGASIGILLPSIAIYIYEISTRELRAKSMLLLGTGFIIGTMLGSIFMSPEQEIGWIWQ
LFIANILLSVVTPVVFLFPESAYWIYMREGADSCERCLTVLRRKEGVQDELQLIREESTS
ANKSTGNIFKFGLGLCLMIVSSLANGALVIYLTTALATSGSSASNFTNCVILQLVGALLS
FFVIDRVDLRRVLLGTLLPITFFVAMLGFNANTNTWTGDANNVFLQLVGCLLYFFLGLGT
STALWASAVGLFPTKQRALYTTFYFMIFFLIPIVALYIRSSPSLYRSAEYVYLYTLAGVC
ILSTIFLFVAGHLSNGLIGTRQEQEVEEAQVRRARASRQSSRLTPGGRMRHINRSRDKSY
NSSGYQLYESPAAGGRLP

Enzyme Prediction     

EC	2.4.1.34:28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT48	860	1594	5.9e-276	0.9499323410013532

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396784	Glucan_synthase	0.0	865	1543	7	701	1,3-beta-glucan synthase component. This family consists of various 1,3-beta-glucan synthase components including Gls1, Gls2 and Gls3 from yeast. 1,3-beta-glucan synthase EC:2.4.1.34 also known as callose synthase catalyzes the formation of a beta-1,3-glucan polymer that is a major component of the fungal cell wall. The reaction catalyzed is:- UDP-glucose + {(1,3)-beta-D-glucosyl}(N) <=> UDP + {(1,3)-beta-D-glucosyl}(N+1).
405046	FKS1_dom1	4.07e-29	163	256	6	106	1,3-beta-glucan synthase subunit FKS1, domain-1. The FKS1_dom1 domain is likely to be the 'Class I' region just N-terminal to the first set of transmembrane helices that is involved in 1,3-beta-glucan synthesis itself. This family is found on proteins with family Glucan_synthase, pfam02364.
340916	MFS_GLUT6_8_Class3_like	3.19e-21	1756	2169	2	426	Glucose transporter (GLUT) types 6 and 8, Class 3 GLUTs, and similar transporters of the Major Facilitator Superfamily. This subfamily is composed of glucose transporter type 6 (GLUT6), GLUT8, plant early dehydration-induced gene ERD6-like proteins, and similar insect proteins including facilitated trehalose transporter Tret1-1. GLUTs, also called Solute carrier family 2, facilitated glucose transporters (SLC2A), are a family of proteins that facilitate the transport of hexoses such as glucose and fructose. There are fourteen GLUTs found in humans; they display different substrate specificities and tissue expression. They have been categorized into three classes based on sequence similarity: Class 1 (GLUTs 1-4, 14); Class 2 (GLUTs 5, 7, 9, and 11); and Class 3 (GLUTs 6, 8, 10, 12, and HMIT). Insect Tret1-1 is a low-capacity facilitative transporter for trehalose that mediates the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source. GLUT proteins are comprised of about 500 amino acid residues, possess a single N-linked oligosaccharide, and have 12 transmembrane segments. They belong to the Glucose transporter -like (GLUT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.
349949	MFS	1.63e-13	1767	2168	2	378	Major Facilitator Superfamily. The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.
395036	Sugar_tr	1.80e-13	1757	2169	1	435	Sugar (and other) transporter.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA17033.1|GT48	CCA17033.1|GT48	0.0	1	2238	1	2237
CCA22009.1|GT48	CCA22009.1|GT48	0.0	8	2233	7	2220
UIZ28646.1|GT48	UIZ28646.1|GT48	0.0	12	2232	14	2221
UIZ28580.1|GT48	UIZ28580.1|GT48	0.0	12	2232	11	2236
CCA17037.1|GT48	CCA17037.1|GT48	0.0	14	2232	10	2241

PDB Hits     

evm.model.AC2VRR_s00077g19-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SFU6|CALS9_ARATH	sp|Q9SFU6|CALS9_ARATH	1.97e-218	81	1744	253	1873	Callose synthase 9 OS=Arabidopsis thaliana OX=3702 GN=CALS9 PE=2 SV=2
sp|Q9SHJ3|CALS7_ARATH	sp|Q9SHJ3|CALS7_ARATH	1.39e-216	41	1744	221	1913	Callose synthase 7 OS=Arabidopsis thaliana OX=3702 GN=CALS7 PE=3 SV=3
sp|Q9SJM0|CALSA_ARATH	sp|Q9SJM0|CALSA_ARATH	3.31e-216	81	1744	265	1887	Callose synthase 10 OS=Arabidopsis thaliana OX=3702 GN=CALS10 PE=2 SV=5
sp|Q9LXT9|CALS3_ARATH	sp|Q9LXT9|CALS3_ARATH	3.28e-215	81	1590	239	1775	Callose synthase 3 OS=Arabidopsis thaliana OX=3702 GN=CALS3 PE=3 SV=3
sp|Q9AUE0|CALS1_ARATH	sp|Q9AUE0|CALS1_ARATH	5.67e-215	81	1573	235	1752	Callose synthase 1 OS=Arabidopsis thaliana OX=3702 GN=CALS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

Start	End
290	312
339	361
386	408
420	442
474	496
517	539
1305	1327
1392	1414
1500	1522
1602	1624
1639	1661
1668	1690
1710	1732
1752	1774
1803	1825
1830	1852
1857	1879
1892	1911
1916	1938
1991	2013
2023	2045
2052	2069
2084	2106
2118	2140
2150	2172