CAZyme Information: evm.model.AC2VRR_s00068g112-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00068g112-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655		74839.78	5.2363

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC068:224608-226575(-)

Full Sequence      

MTLVTNENVDDNYNCEAMGSIKNRLLLARNVIVSAPVKLRCLQPKKIAPPKARTELLKSS
VQNATSYNVTSMDLEKIYCSGPLLHAIQTADIYKDSKQFVDMAIREEFTVDMILTNFNQL
VTNSASTSLSRAQLEEFVHKHFHNAGNDLIPAIPIDFKEQVQLQRIASITDQELRQWAMG
LHELWKSLGRLPNANVRSSFLRVPPIHNVKALERNYNNENLLILPGGRFLESYYWDSYWI
VEGLLVSEMISTARGVVNNLLEYASYLGFVPNGGRIYYLTRSQPPMLSDMVRLVAKSQNA
DDKAEWDLDYLTAALPILEKEYSFWMHTKPHFNEVTQQTYAPHAVEIEKDGKTYTLNRYV
ANANAPRPESYQEDFEMAERIFGSHEAEPVVTDTVMSNTSRNRFYNDVIAAAESGWDFSS
RWFRDRQTLDTVYTESIVPVDLNAILYRVEVNLSQFHRVLGNLKEATMYEMFAQRRLAAI
NAILWNEQLYCWKDYDMETRAPVSLTEYSASDYFPLWARAYDMTDVVCKQQILESLRDRS
TLIQIGGIRMTTISTAEQWDSPNAWPPVQDIIVDGLLGLDLPEGTELAKVVVQRWITNGL
TAWRRSGVMFEKYSATKLGETGDGGEYEPQTGFGWSNGVILKFLTTHQNLYRSSS

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	92	645	2.1e-160	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	9.09e-175	78	644	13	541	alpha,alpha-trehalase
395961	Trehalase	1.55e-159	92	645	2	506	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	5.19e-100	70	645	48	550	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	1.29e-87	81	644	49	533	alpha,alpha-trehalase TreA.
183936	treA	4.88e-87	83	655	52	540	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18366.1|GH37	0.0	1	654	28	690
CCA17720.1|GH37	0.0	1	654	28	690
AOW41677.1|GH37	2.55e-199	59	648	32	610
UIZ20368.1|GH37	2.79e-195	71	650	174	745
CCA21422.1|GH37	3.70e-192	70	650	158	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	7.39e-107	95	644	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.13e-105	95	644	40	551	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	9.48e-78	81	644	52	536	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	2.91e-73	81	644	15	499	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	8.63e-69	81	644	15	499	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43280|TREA_HUMAN	1.74e-125	76	644	31	547	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	9.62e-123	76	644	28	544	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	3.91e-119	77	647	45	568	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q9W2M2|TREA_DROME	5.08e-118	76	647	54	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	1.45e-117	76	649	48	573	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000001

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00068g112-p1.