CAZyme Information: evm.model.AC2VRR_s00068g111-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00068g111-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705		81731.84	8.8757

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC068:222342-224459(+)

Full Sequence      

MTPSNESDTQFNESPMQLNTKEFRHGITPTKSAAKYKVMKLNAPKWMFVFLLFSTVISTK
HEHFQIHLISTELNDWDWSIVSNLLSSRRDHTAFKVASIENVTNKQTWWLRQLDNHTLEM
MSLYCQGDLMHSVQMADIYPDSKHFVDMPLRRNTTYTAVIREFEQKKLSFHTFLEMYNYT
NDTHKILYQNSLREFVSKHFDQPGSDLNPVTPMDFREQISPPMIANILEPEYREWAFELY
QAWKYLGRSPKRGVRGSFLHTNTKGLKAPHVVVVPGGRFRESYYWDSYWIVTGLMVSNMK
QTAKGVVNNLLKYVEEFGFVPNGGRIYYLTRSQPPLLSDMVKIVALREHLATGIMYDIDY
LRYAVPLLDREYSFWMEKGPSGHAVELLRHDTNGSVRSPVRYVLNRYISTANHPRPESYR
EDVTIASDMYPFSIAAYAANRSDPQKVHFQRNQKMKYTYYNDIIAAAESGWDFSSRWLRN
GVDLRTISTSSIIPVDLNAIMYRMERNMMEFHRILGNSKQEKKYKRAARDRAEAIHAILW
SDKESTWKDFDLMTNLHSSIPSISDYSPLWAKAFDAKDTDRLGRVVKSFKNSGLIKIGGA
QTTTLFTGQQWDAPNAWAPAQDIMIEGLLHVNNAEAHELARELAKSWIRTSHTAWEHTGL
MYEKYNSTELGGLGAGGEYFTQFGFGWTNGVILKYLTIHHNLLED

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	138	697	1.4e-164	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	7.07e-179	117	696	6	541	alpha,alpha-trehalase
395961	Trehalase	5.35e-144	138	699	2	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	1.18e-97	127	697	59	550	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	2.95e-86	127	696	49	533	alpha,alpha-trehalase TreA.
183936	treA	1.17e-85	128	699	51	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA17719.1|GH37	0.0	1	705	1	707
CCA18365.1|GH37	0.0	1	705	1	707
CCA21422.1|GH37	2.45e-256	87	705	132	746
UIZ20368.1|GH37	1.42e-248	121	703	175	746
AOW41677.1|GH37	2.56e-212	119	703	46	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	7.31e-107	140	696	39	551	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.11e-105	140	696	39	551	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	2.60e-80	127	696	52	536	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	5.23e-78	127	698	15	501	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.14e-72	127	698	15	501	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8J4S9|TREA_APIME	6.95e-121	123	696	45	565	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q9W2M2|TREA_DROME	2.52e-115	123	699	55	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	1.01e-114	123	705	49	577	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	1.01e-111	123	696	29	544	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	4.82e-111	123	696	32	547	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999888	0.000099

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00068g111-p1.