CAZyme Information: evm.model.AC2VRR_s00066g91-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00066g91-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		49441.98	6.8883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC066:207202-208506(-)

Full Sequence      

MHNELHISYPFRVVTPTVLQNGFLTHVRIAFPNTTHYEIIASDAFSVTVQFHTQSQGHCT
AYLVRGSPYITVHYHNSAPILHSGQSIEWIRLKKNENNDNENLASYRFLTSTNQMWQLFL
SDSTSELRMESNSIISQSPLNGILRLAITLDALNQPLLQHCAPVYPTGGSIKYIQDKKRE
NSLKIQYHWTVKTFGSSDKSIPLLMLTLPHHRDIIQFQKVGNVSRKRNMTDENVLVEELT
FVSMRGVMKGVLGNVWYMMEELPNIYWDYEAGGLLSSDLSTDVGLMDSIRSTIGIDTIKE
NESDPKESIQSFIRNKLTTLLTKEYKTIPNFAEDSYTFGKQIGREARLLLMAKQLHHNEA
AQVLLARIKTALEPWLDGSNSDHFVYDKTFGGIITSKGWSDQNADYGNGYYNDHHVSVTA
FVRYDFVNLNAFCT

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00066g91-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	3	422	7.4e-80	0.5466237942122186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397619	Glyco_hydro_81	2.63e-24	31	265	90	312	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
407548	Glyco_hydro81C	1.15e-20	335	415	31	113	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.11e-19	24	415	155	511	Endoglucanase Acf2 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18874.1|GH81	8.04e-242	1	422	58	479
UIZ29064.1|GH81	1.49e-81	1	422	103	533
AUX36386.1|GH81	2.08e-37	37	422	156	482
CAN97272.1|GH81	7.30e-37	5	422	128	487
UQA58532.1|CBM6|GH81	2.90e-36	4	415	332	683

PDB Hits     

evm.model.AC2VRR_s00066g91-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AIR7|ENG1_CANAL	2.35e-11	63	423	574	902	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.05e-10	42	415	122	459	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.96e-10	103	422	224	501	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.36e-07	63	415	543	865	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00066g91-p1.