CAZyme Information: evm.model.AC2VRR_s00060g162-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00060g162-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		40022.46	4.9566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

Full Sequence      

MSASEAFAIQSKPIISASIHRVLSIILWSAIPTINGHGHLVYKTEKGYDPLCVFKAGVDT
TAYSAIVNGTRMCPGYELSTGPETNVANYDKCMKAKYKYATLAEFIRKNQVVEPGATPID
GYTLPDQMASVVINKTLIFGNDLGHHGPCSVMCDEKEVVYELNCHFKFTGKPAVIPIDFD
TCSKAKKVWFYWVAMHGAGWQVYTNAFPVKSSSSGNKESTEGSNEYSDPTKTNVNEGTQL
DTKNDATPNPDTKPAPETTPPSETKPAPETTPPSETKPAPETTSPPETTPPPETTTKPET
ATKPETTTKPDTAAKLEEETTSKGAGEVYPAGDKGNEEESTTDNSGGSDSTEKNTNQQET
ASQKSKCTLRT

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00060g162-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	27	281	9.7e-36	0.926530612244898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411414	MSCRAMM_ClfB	2.82e-04	248	362	554	668	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	4.87e-04	228	365	545	677	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411408	PspC_subgroup_2	0.003	247	368	393	515	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
223033	PHA03291	0.009	247	331	209	295	envelope glycoprotein I; Provisional
411414	MSCRAMM_ClfB	0.010	245	363	538	657	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCI46093.1|AA17	CCI46093.1|AA17	1.45e-161	72	371	1	300
CCA20830.1|AA17	CCA20830.1|AA17	1.79e-73	21	209	20	207
EGZ08731.1|AA17	EGZ08731.1|AA17	1.12e-25	23	204	8	195
ETL88399.1|AA17	ETL88399.1|AA17	2.92e-25	15	215	3	209
ETI41730.1|AA17	ETI41730.1|AA17	2.92e-25	15	215	3	209

PDB Hits     

evm.model.AC2VRR_s00060g162-p1 has no PDB hit.

Swiss-Prot Hits     

evm.model.AC2VRR_s00060g162-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.060097	0.939869	CS pos: 36-37. Pr: 0.8653

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00060g162-p1.