CAZyme Information: evm.model.AC2VRR_s00060g137-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00060g137-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		46227.96	6.2807

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC060:279245-280459(+)

Full Sequence      

MKTCILIPILCTQSFANNQYPPNPPAYNPGPWNNPQQKRHVQWDIREGKVRSKGVNLGGW
LVLESWMTQGSDFWKNFDEATQKQGEYRIMKALGHQVADPLVVKHRETWITEQDIAKIAA
SGMNLVRVSTGYWITENLVPVAPHIQEDISVHTPGGLLYLDRLIFDWAVKYNVAVIVSLH
GHVNSQNGRDHSAAKEFQNPQWSNDPEAQKASLEWAKFIAARYRSSDSFLGMTLMNEPEY
PTKVEDVKNFYNAAYQAIRSTGDSCILILCPMLTEQDNNHGWQNFMRTTYNVWHEWHPYF
KWGYENQNMDQVLESVNKKGSDIAAWTGNCLFIGEWSMDSSDSANFEARRETLTNFGNVQ
KNAFKRAACGTTFWSWRASDPLTINYGWSMNELIQENLLGMGDA

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00060g137-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	103	378	4.2e-40	0.9602888086642599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.72e-17	53	327	19	271	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	5.51e-12	105	376	20	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA23489.1|GH5	1.68e-226	1	404	1	402
CCA15900.1|GH5	2.94e-112	40	399	101	452
AAM18484.1|GH5	8.33e-105	41	399	9	368
AIG55478.1|GH5	1.52e-103	40	399	14	373
UIZ29723.1|GH5	6.27e-103	45	404	5	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PB1_A	4.23e-33	40	346	5	303	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1EQP_A	5.30e-33	43	346	2	297	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	7.94e-33	40	346	4	302	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	1.11e-32	40	346	5	303	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PC8_A	1.11e-32	40	346	5	303	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29717|EXG1_CANAL	1.07e-32	40	346	43	341	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q8NKF9|EXG_CANOL	4.42e-32	37	346	24	329	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
sp|Q12700|EXG_SCHOC	4.16e-31	38	346	30	329	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	5.89e-31	49	346	28	307	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q12626|EXG_PICAN	9.05e-31	38	402	37	417	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.508382	0.491637

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00060g137-p1.