CAZyme Information: evm.model.AC2VRR_s00060g109-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00060g109-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		59424.95	7.5162

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC060:221821-223383(+)

Full Sequence      

MNRLQRVLISLFLGICICLVSIFYVSRHNMFQNLLKAHDEMYANTFASTTERKSNAVQWR
PFTDLQELEQYECVQFHHTADCSPTGASIRTLNCSAPIKGSASGYCEIQHRITGEKRFVL
NRRCGATRTKVEIPCHEFRNVLGHALQAKAFKPNPPATAATGQKLLQDENPSLTLPSSIF
DRGIAIVISPRSIQSVYASIKWLRHIGCTLPVELWYRADEFTFINMMEGKTIATHPIIAD
LIKTHDVFLRQIDPKAQAESWFTKIYAVSYSAFKQLLLLDADNFAVSDPTSLFESDAFAT
TGAIFWPDYWLPDRTLFFMNDHSLVWEMLNVKNVYMFEQESGQVLIDRERHAIAVSTLSY
FGLRRPRLLVDLGFAWGDKDLFRFAWMTTNSSFHFIAGPPGSAGILLREKKLFCGQSIVQ
HDPDGNIIFLHRNKQKLVADNMHSVWTHIQEYNTADLSRFHVRINDGAKDFSKWGISQCF
GKYSDYERDYSMTAVENLPFADIEATLFDYVKKSSVLEAR

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00060g109-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	182	422	2.6e-50	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.09e-30	182	422	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.001	262	309	79	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA20051.1|GT71	6.77e-285	1	519	20	538
UIZ24000.1|GT71	5.01e-110	71	507	104	560
UIZ24059.1|GT71	1.49e-108	44	518	684	1177
CCA25989.1|GT71	3.95e-104	42	509	72	534
AIG56191.1|GT71	5.24e-88	69	520	41	492

PDB Hits     

evm.model.AC2VRR_s00060g109-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AP90|MNN23_CANAL	4.25e-14	175	423	164	450	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|P38069|MNN2_YEAST	4.97e-12	164	422	138	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q59KJ7|MNN21_CANAL	1.64e-11	169	435	232	539	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|Q5A687|MNN22_CANAL	2.64e-11	175	446	153	458	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|P46982|MNN5_YEAST	1.41e-10	183	440	151	451	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994029	0.005993

TMHMM  Annotations     

Start	End
7	26