CAZyme Information: evm.model.AC2VRR_s00036g22-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00036g22-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		64061.28	6.9452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC036:46612-48333(+)

Full Sequence      

MVSTRYIALSGGLLQTCVAHISTPLPVRLLRDYDQSNQYDSYGNQPSNPYGNGDGNQPTN
PYGNGNQLPNLYRSSGNYPPPLLAQYPYNDRFNPNGPGSYNNRPPPSYSSYDQNGPGRYP
NGPPPNYPNNNQNGLGPYSRPPAYYPPFTPRGSANFDSPQPGQNFYSPSPTPPMYPPSRY
PYEYRNYPNGGGQNDQFSYQPSGGRQVNPGGGVEELVRAIKRGKTKVDGVSLNWLLAESW
LSPDNKLWDDTTKEERYNERSFMNAPAKGKSRAELIDEYRKTWYTKDDLANIKRAGYNTV
QVNVGYWIINEPRDSDDAAFTSAIDYLDLLINQWASSLQLAVIVTLRAHKGCHNLEASSN
CPVKEVNWGSGKSIADSVDFALKIASRYENSGAFLGMELLPNPAAPITQEQLERYYSEVN
MILKERRNDCILVIAGLDANDLLVWQEFTKDFSNVWLGYPSFVFWGFENKRKEDLFKEIG
NRGDKLQKYKEGGLKVLVTGWAAAAPASAQMSTPSDYGELVGNQMQAYSHAQAGSVTVCW
KVKAVKYTLEPFDTESMLIFKALAPRGDARHYL

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00036g22-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	275	543	3.8e-25	0.9638989169675091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.28e-07	281	425	71	213	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29723.1|GH5	1.36e-40	220	541	5	337
AAM18484.1|GH5	7.39e-39	214	541	7	345
CCA15900.1|GH5	6.92e-38	214	541	100	429
AIG55478.1|GH5	7.11e-37	218	541	17	351
CCA23489.1|GH5	5.43e-35	220	541	42	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H4P_A	5.88e-08	227	407	13	197	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CR35|EXGA_ASPTN	2.17e-16	217	455	24	263	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
sp|Q12628|EXG_KLULA	3.71e-10	226	434	35	249	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1
sp|Q96V64|EXG_BLUGR	1.44e-08	213	404	23	210	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|P23776|EXG1_YEAST	1.44e-07	227	407	53	237	Glucan 1,3-beta-glucosidase I/II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXG1 PE=1 SV=1
sp|Q5AIA1|EXG2_CANAL	2.67e-07	229	418	44	242	Glucan 1,3-beta-glucosidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXG2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.900494	0.099506

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00036g22-p1.