CAZyme Information: evm.model.AC2VRR_s00011g55-p1

Basic Information

• Species: Albugo candida
• Lineage: Oomycota; NA; ; Albuginaceae; Albugo; Albugo candida
• CAZyme ID: evm.model.AC2VRR_s00011g55-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283		30980.10	7.7484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Acandida2VRR	15896	911350	72	15824

• Gene Location: location=Acan2VRR_SC011:123163-124014(-)

Full Sequence      

MTVATNSCACPCAASSTKEQKVNLNKIREELVGIFEGNGKIGPTLVRVAWHASASFSGRD
GSGGSDGGRIRFKPESAWVKNTGLDKAVAVLDQVQKNNPEITHADLYIFAGVTMIEIMGG
PKVPFRLGRKDAPDGSTSPPDDRLPSADKGCPVKTAAHVRDVFSRLGFNDRETVALIGAH
AVGRAHPELSGFSGPWTETERKFSNKYFKNLLNVEWKPTEGKSPTQFNNPSKTLIMLPSD
MVLIQDEAFRPFVKLYAQNEELFFKDFAVAFQKVTENGVNFED

Enzyme Prediction     

No EC number prediction in evm.model.AC2VRR_s00011g55-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	26	279	1.4e-56	0.9686274509803922

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	9.00e-113	13	282	2	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	8.04e-65	43	278	32	243	L-ascorbate peroxidase
173823	plant_peroxidase_like	1.73e-57	26	276	2	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
178467	PLN02879	3.01e-55	18	278	11	246	L-ascorbate peroxidase
166005	PLN02364	1.62e-54	17	278	9	246	L-ascorbate peroxidase 1

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	6.53e-99	16	283	62	331
BDA47129.1|AA2	4.94e-78	14	283	78	350
QKY15243.1|AA2	1.56e-74	18	283	106	366
KGB79457.1|AA2	6.12e-71	27	283	12	274
QRD85779.1|AA2	2.18e-69	38	282	110	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AMM_A	2.53e-69	17	278	1	258	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIV_A	2.61e-69	16	278	1	259	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
3RIW_A	2.61e-69	16	278	1	259	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]
4GED_A	3.37e-69	17	278	1	258	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AL9_A	3.59e-69	17	278	1	258	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C0V3|CCPR_EMENI	2.12e-69	17	281	86	347	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	8.70e-69	13	283	78	348	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|Q6C0Z6|CCPR_YARLI	1.31e-68	38	281	88	326	Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=CCP1 PE=3 SV=1
sp|Q6CAB5|CCPR2_YARLI	4.13e-68	25	279	7	261	Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=YALI0D04268g PE=3 SV=1
sp|Q6BIB1|CCPR2_DEBHA	5.14e-68	38	279	175	413	Putative heme-binding peroxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=DEHA2G12166g PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in evm.model.AC2VRR_s00011g55-p1.