CAZyme Information: ZTRI_9.544.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_9.544.mRNA-p1
• CAZy Family: GT50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		48659.13	9.0566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_9:1793940-1795205(+)

Full Sequence      

MLVRLPRPRRIAFVVLAAVAVLFFLFKGEGNSHPVDIQALQNYDGALAARQPTSDEEIGA
MCRKHGFTQYREQGSRKRKVYDMFLISTELDWLEIRLNTLAPYVDYFIIVESPTTFTGMH
KPLHLEQNWKNFTKFHDQIFHTVVKDPGPSLGYSTWTHEDFMRDSLYFSAFAALTGKKEA
REGDVIIVSDVDEIPKPETLIALRNCDIPDRVTLRSHFYYYSFQWLHVGQQWPHPQATVF
KTLSTTIKPSHLRAGIGGIQTSIPFLGAIRRWREKADMWDAAWHCSSGFATLREVITKMN
SFSHTPLNTPENRDRENIKDRVRNGKDLYGRRGERYQRVDNNHDVPQYVLENRQKYGYLL
DRDGKTAGFEDWNVTEEDEKAAMEARRKARQEENLKIQQAFQKAEEIAAKKAAAERAKQG
A

Enzyme Prediction     

No EC number prediction in ZTRI_9.544.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	60	361	6.9e-81	0.9823943661971831

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	1.07e-53	62	360	61	342	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR61744.1|GT17	1.14e-311	1	421	1	421
SMY27959.1|GT17	1.88e-310	1	421	1	421
SMQ54319.1|GT17	1.96e-310	1	421	1	422
SMR58745.1|GT17	2.68e-310	1	421	1	421
UJO21127.1|GT17	5.48e-146	7	373	10	385

PDB Hits     

ZTRI_9.544.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

ZTRI_9.544.mRNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992223	0.007794

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_9.544.mRNA-p1.