CAZyme Information: ZTRI_9.535.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_9.535.mRNA-p1
• CAZy Family: GT48
• CAZyme Description: similar to Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		48001.40	9.1269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_9:1776119-1777501(-)

Full Sequence      

MALFRQAWSLVTDPKSTKWTAPLQLLADAVLCGAVILKIPYTEIDWSTYMQQIELYLSGQ
RDYAKITGDTGPLVYPAAHVYIYRFLYYLTSNGTDIFAAQCIFAGLYLATLWIVMQCYRA
ANVPPYIFPLLSLSKRMHSIFVLRLFNDCWAVFFLFAAIWCWQRKLWTFGTLMYSVGLGV
KMSLLLPLPAIGVVLWQGMGRDRAFYQAQSIGQVQTLIAYPFIWGGIWSYITRAFDFSRQ
FLYVWTVNWRFVSEATFLSKPFSYGMLILHVFLLHLLGVGRWLRPAGVSLGGAIEQLISP
PSKDELRRIAARVTPDFTLTAILTSLIIGCLCARSLHYQFFVYIAWSVPFLLWRSGMSVV
MIYAICFAQEWAWNVYPSTNASSAVVVGSLAVTVFSIWIGTSYYVNPPKEAQKVEAEHTK
AE

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	22	383	1e-136	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	22	383	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ54309.1|GT58	5.84e-310	1	422	1	422
SMR58736.1|GT58	4.80e-309	1	422	1	422
SMR61735.1|GT58	4.60e-307	1	422	1	422
SMY27950.1|GT58	6.54e-307	1	422	1	422
UJO20555.1|GT58	5.16e-203	1	416	1	416

PDB Hits     

ZTRI_9.535.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	3.78e-136	3	400	14	421	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	1.75e-132	10	413	10	409	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	6.31e-129	10	410	72	469	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	4.78e-126	10	403	18	404	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	1.93e-123	10	403	10	396	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999946	0.000101

TMHMM  Annotations     

Start	End
96	118
140	162
174	196
211	230
251	273
316	338
351	373
383	405