CAZyme Information: ZTRI_9.408.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_9.408.mRNA-p1
• CAZy Family: GT4
• CAZyme Description: similar to mannan polymerase II complex ANP1 subunit Anp1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		57161.75	6.4606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_9:1324437-1326120(-)

Full Sequence      

MLPSYVSSAQQEKMNRHGYGGSNGTPRGAGAYPMGSNKTGFSIRPDKYEKYQPRSSRGLS
LRRRSTLLRVGGACTLILILMIVFPSLRPGFLVAPLSMGLLSSGDPFQLETVRYYDLSHV
GGTSRGWEREERILLCAPLRDAAPHLPMFFSHLRNLTYPHNLIDLAFLVGDSKDNTLPIL
SDLLAELQAQQDPKMAFGEISVIEKNFGQKVDQDVESRHGFAAQASRRKSMAQARNWLLS
AALRPTHSWVYWRDVDVETAPFTILEDLMRHNKDVIVPNVWRPLPDWLGGEQPYDLNSWQ
ESETALALAETLDEDAVIVEGYAEYATWRPHLAYLRDPYGDPDMEMEIDGVGGVSILAKA
NVFRSGVHFPAFSFEKHAETEGFGKMAKRMKFSVVGLPHYTIWHLYEPSVDDIRHMEEME
QERKQREAEEKQKKERAEKIQNQFEVAADKTQWEKDKEQMKGMTEAEAAKRAAKLAARKA
EAVVDKSSGDQHAPEKQAEEAAPQKAG

Enzyme Prediction     

No EC number prediction in ZTRI_9.408.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	110	373	1.5e-121	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.15e-158	111	373	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ54177.1|GT62	0.0	1	507	1	507
SMY27817.1|GT62	0.0	14	507	1	494
SMR58611.1|GT62	0.0	14	507	1	494
SMR61606.1|GT62	0.0	14	507	1	494
UJO20889.1|GT62	3.85e-261	1	468	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.67e-61	112	409	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	2.41e-158	111	424	61	374	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	4.44e-154	41	424	14	391	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	1.35e-122	111	424	171	531	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.55e-114	112	424	76	438	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	5.04e-62	112	407	73	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000012

TMHMM  Annotations     

Start	End
65	87