CAZyme Information: ZTRI_9.153.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_9.153.mRNA-p1
• CAZy Family: GT34
• CAZyme Description: similar to alpha 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428		49708.06	6.4002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_9:553695-555038(-)

Full Sequence      

MASSTKYLRFILLAIVCLILIVLFSSSSSSIPGGHHIQSAADILRAQGIWKGTGDRVASS
NTFTQDVTDKEKIAIPQHNLPAFEDTTSPNPGAGKQLPVAAAPGERLNATFVTLARNSDV
WEISRSIRQVEDRFNKAYNYDWVFLNDAEFDDQFKKVTTALTSGKARYGKIDEKHWSFPA
FIDQDKAKRVREDMHERKIIYGDSISYRHMCRYESGFFFQHPLMLEYEWYWRVEPSIELY
CDISYDPFKFMADNKKKYSFVLSLYEYVETIPTLWDSVKKFMTKHPEHITEGNAMAWLSP
DGGETYNHCHFWSNFEIGNLNWLRSKAYTDYFNFLDTEGGFFYERWGDAPVHSIAAALML
KKEEIHFFNDIAYYHVPFTHCPTGEQIRIDNKCHCNPKDNFDWNGYSCTAKWYDVMNMPK
PAGYEKEQ

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	106	376	3e-125	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	2.39e-179	85	425	59	399	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	5.61e-155	90	377	26	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ53908.1|GT15	0.0	1	428	1	428
SMR58345.1|GT15	0.0	1	428	1	428
SMY27545.1|GT15	0.0	1	428	1	428
SMR61324.1|GT15	0.0	1	428	1	428
UJO21397.1|GT15	1.38e-249	1	428	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	5.73e-130	109	426	29	345	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	1.41e-91	101	393	61	358	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	4.02e-85	106	412	102	421	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27810|KTR1_YEAST	1.94e-158	96	425	62	389	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1
sp|Q00310|MNT1_CANAL	2.21e-154	54	426	57	428	Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT1 PE=3 SV=1
sp|P46592|MNT2_CANAL	4.01e-152	105	428	138	461	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|P38130|KTR3_YEAST	3.27e-137	104	423	83	403	Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR3 PE=1 SV=1
sp|P27809|KRE2_YEAST	6.77e-128	109	426	123	439	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.708186	0.291834

TMHMM  Annotations     

Start	End
7	24