CAZyme Information: ZTRI_9.14.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_9.14.mRNA-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	Ztri_chr_9|CGC8	50333.36	3.6730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_9:48211-49789(-)

Full Sequence      

MQLSIALSLVSVLVHAQQAPVYGGDVTTTPPPPAYEEPATSTSTFFSTVDTCPGNSCSTT
VSSSSALATVSAPPTIITKRIPQCALNCIVGYDLGGCDPEDVTCICSNIALIDRYSCCLS
QQCLSQDDINAIRDVGDLLCSCFGVFDAVPNNASCLAVDPPRPVQQTISPNGVCGGPNNY
NCVGSEYGDCCSQYGFCGSGYEFCAAQNCLTDYGSCNPAGQPPYSTSPASAAPPPTYTQT
PSPNGYCGSSNQANCAGTVFGDCCSIYGYCGNGTEYCAPDTCQTGYGNCGSPYVDAPNVV
YTTAAPAATTGVCSNILESVTDQLTLPTTTSTSPATYSAPPVTTTSTNRPTPTGLPLCAQ
GCIATYAESACYGGCSPLDVACICSNKPLLADFSCCVSQFCDPGQIEDVRLFANTICSRA
GVSSIPQEATCLPTAIAASSTIPGCATPFPTTTTMSSMSMGAMTTCGVCTSCERVTTVIP
VMEASSYTAVF

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	1.34e-07	247	290	2	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	5.72e-06	174	217	2	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
399033	CFEM	1.86e-05	351	418	1	66	CFEM domain. This fungal specific cysteine rich domain is found in some proteins with proposed roles in fungal pathogenesis. The structure of the CFEM domain containing protein 'Surface antigen protein 2' from Candida albicans has been solved.
399033	CFEM	0.005	81	141	5	66	CFEM domain. This fungal specific cysteine rich domain is found in some proteins with proposed roles in fungal pathogenesis. The structure of the CFEM domain containing protein 'Surface antigen protein 2' from Candida albicans has been solved.
395135	Chitin_bind_1	0.009	261	283	14	35	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ53769.1|CBM18	0.0	1	491	1	491
SMR58203.1|CBM18	0.0	1	491	1	491
SMR61180.1|CBM18	0.0	1	491	1	491
SMY27403.1|CBM18	0.0	1	491	1	491
QRD05503.1|CBM18	4.68e-17	152	289	201	316

PDB Hits     

ZTRI_9.14.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WNE1|CFMC_ASPFU	4.04e-10	354	441	24	115	GPI-anchored hemophore cfmC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cfmC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999749	CS pos: 16-17. Pr: 0.9824

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_9.14.mRNA-p1.