CAZyme Information: ZTRI_8.222.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_8.222.mRNA-p1
• CAZy Family: GT31
• CAZyme Description: similar to glucose-methanol-choline oxidoreductase:gmc oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		66161.73	4.6859

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_8:804338-806581(-)

Full Sequence      

MFQLSTRAILLGCMTTAQLVAASGPPDFSTYQYSDAPPIDFESSYDFCVVGGGTAGLVLG
NRLTESGKFNVIVFEAGPTPDSVPTSLTAGGNQFLLNGGRSLIDYNFVTVPQPGLKNRTL
NYHRGRCLGGSSATNGLYYGLGSTGVYDQWEADGNPGWNASTIFSAAKQGTVFVGNPKNS
NDPTYMTWNPDNYGTEGPLKIGFQGYVPASNPGFMNATAAIGIPGTMTLDENFERVSSYD
SYYQASKDRKNLNVRGSATVVRIIFDEATIGTDEAHAVGVTFVEAGIFHNISCSNEVIVS
AGAFHSPFLLKQSGIGPQDELDKYGIPVVVANENVGHHMQDHTSFSVIYSVKPEFADIAS
TTDMVNDLTVLNEEQRKFYSTADPFEKAKSKWSAPSGCTNAFQEISNDELKQIGAGAVVD
AGFLHQAHNEILYESVWYPQAFNEYGQPLRNTSYISLTVSNLAALSKGSVTVGSNSALSD
PVINPNYLNETADQAMAVQGVKYLRQIGEHPAWKQWVQEEVSPGPAVQSDEDILEYARTS
IIPNWHASSTCRMLPKEKGGVVDNKLRVYGTKGLRVCDVSTFGRLPDVNLVGPVYAVAER
GSQIIREEYGDL

Enzyme Prediction     

No EC number prediction in ZTRI_8.222.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	44	607	1.5e-147	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.52e-80	42	606	3	532	choline dehydrogenase; Validated
225186	BetA	8.41e-76	44	608	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.65e-37	466	600	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.27e-27	10	610	10	582	Protein HOTHEAD
366272	GMC_oxred_N	1.38e-15	117	343	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR59655.1|AA3_2	0.0	1	612	1	612
SMY26845.1|AA3_2	0.0	1	612	1	612
SMR56796.1|AA3_2	0.0	1	612	1	576
SMQ53215.1|AA3_2	0.0	50	612	16	542
QRC95964.1|AA3_2	0.0	1	612	1	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	1.28e-60	45	605	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	3.42e-60	45	605	8	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	3.42e-60	45	605	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	4.64e-60	45	605	24	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	9.11e-60	45	605	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5GMY3|GMCH_MALSM	5.53e-63	44	605	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	5.53e-63	44	605	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q12062|AFLK_ASPPU	4.49e-62	44	600	74	634	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.36e-59	43	607	39	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A248QE08|FAP_CHLVA	6.87e-59	45	605	84	636	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.500655	0.499324

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_8.222.mRNA-p1.