CAZyme Information: ZTRI_7.442.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_7.442.mRNA-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	Ztri_chr_7|CGC5	45616.08	8.4613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_7:1418243-1419630(+)

Full Sequence      

MERQQQLISDIHDMYTMAVPKIKSSLRHRNLRFYASCGAIAALFLLVSSSGRVSSTVHSF
RSTIQDATNSTLGFEKIIVMGMPERHDKRDALTLAASLSDLEFEWEAGVDGSAIVEKAKP
PIMDKELTLSNKTLGCWRAHMNALQRVVKENIQTALIMEDDVDWDVNIKQLALNLAHGTK
YIEGSENRATRSPYGDDWELLWLGHCGMMKKPEPLARYYITDNDPTVVPPSHFHFPKRPL
LDQPPLSANFTRLVFKPELGICAYAYAVTLEGARRLLHQETQSFTSASAADFALRRFCRV
YKNWGTAANCIGAWPSLFTSYRAPGPTGKDSDRTTYAGPAWRDVGMSSHTVFSTRLNFEA
LLKPRGGSQRVIKSQWPDETLLREYTGELKLPQGRGIELVGHERLP

Enzyme Prediction     

No EC number prediction in ZTRI_7.442.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	75	280	1.4e-26	0.9281767955801105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	5.43e-20	76	167	1	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	4.84e-06	74	277	1	186	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR55407.1|GT25	3.08e-293	17	406	1	390
SMY26218.1|GT25	3.08e-293	17	406	1	390
SMQ52585.1|GT25	4.13e-246	80	406	1	327
SMR57784.1|GT25	4.05e-188	158	406	1	249
USW54837.1|GT25	8.25e-114	25	397	3	381

PDB Hits     

ZTRI_7.442.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NBJ5|GT251_HUMAN	2.45e-09	68	283	334	516	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1
sp|Q8K297|GT251_MOUSE	1.00e-08	68	277	329	505	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|A5PK45|GT251_BOVIN	3.11e-08	63	277	330	511	Procollagen galactosyltransferase 1 OS=Bos taurus OX=9913 GN=COLGALT1 PE=2 SV=1
sp|Q6NVG7|GT252_MOUSE	6.45e-06	72	213	338	478	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2
sp|Q8IYK4|GT252_HUMAN	6.45e-06	72	213	339	479	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999127	0.000886

TMHMM  Annotations     

Start	End
31	53