CAZyme Information: ZTRI_6.445.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_6.445.mRNA-p1
• CAZy Family: GH92
• CAZyme Description: similar to endo-beta-1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		24131.42	9.2202

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_6:1657844-1658655(-)

Full Sequence      

MLFTRALLGLAAATYSLAAPITEASPNPDSATHLFARESPGTGTNNGYYYSFWTDGGGQV
NYNNGPGGSYTVSWSNVGNFVAGKGWATGSARTINYSGSFNPSGNGYIAAYGWTRNPLIE
YYVVESYGTYNPSSAAQKKGTVTTDGGTYDILQTTRVNQPSIDGTQTFQQFWSVRQQKRV
GGTVTMKNHFDAWSRLGMKLGSSQNYQILATEGYQSSGSASITVS

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	46	223	6.5e-78	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	2.45e-110	46	221	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY25466.1|GH11	5.95e-163	1	225	1	225
SMR56284.1|GH11	5.95e-163	1	225	1	225
SMQ51822.1|GH11	5.95e-163	1	225	1	225
SMR54207.1|GH11	4.89e-162	1	225	1	225
ABG33753.1|GH11|3.2.1.8	4.93e-106	3	224	4	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HIX_A	3.57e-95	42	225	9	190	Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38],1HIX_B Crystallographic Analyses Of Family 11 Endo-Beta-1,4- Xylanase Xyl1 From Streptomyces Sp. S38 [Streptomyces sp. S38]
5EJ3_A	1.74e-91	43	224	51	230	Crystal structure of XlnB2 [Streptomyces lividans],5EJ3_B Crystal structure of XlnB2 [Streptomyces lividans]
7DFM_A	5.35e-91	42	225	10	191	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
1TE1_B	1.52e-89	42	225	8	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
7EO6_A	7.28e-89	42	224	11	190	Chain A, Endo-1,4-beta-xylanase [Actinomycetia bacterium],7EO6_B Chain B, Endo-1,4-beta-xylanase [Actinomycetia bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ52|XYNA_NEOFI	4.11e-102	16	224	16	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnA PE=3 SV=1
sp|Q4WG11|XYNA_ASPFU	1.18e-101	16	224	16	227	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1
sp|B0XXF3|XYNA_ASPFC	1.18e-101	16	224	16	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnA PE=3 SV=1
sp|P55332|XYNA_EMENI	8.68e-101	34	224	34	224	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1
sp|Q0CFS3|XYNA_ASPTN	8.25e-98	3	224	4	230	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000362	0.999609	CS pos: 24-25. Pr: 0.8880

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_6.445.mRNA-p1.