CAZyme Information: ZTRI_6.240.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_6.240.mRNA-p1
• CAZy Family: GH79
• CAZyme Description: similar to glycosyltransferase family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	Ztri_chr_6|CGC11	47971.02	6.5635

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_6:996170-997435(-)

Full Sequence      

MKLGGGPNIKGPQDLFNSVPMGVPKQLQRLLPACIALLLFLYFMTGSGPSTSLAIFSRPK
PTHFPRKIWQTWKVDPMMFEERDHNTARTWIIKNPDFRYEVLTDENDLAYVETHFGPEGF
NRPDIVYVYRELTARIIKADLLRYMIMYVEGGLYTDIDVEALKPVKNFIPKRWEETDIDM
VVGIEIDQPEFSDHPVLGSKCKSFCQWTFMCKPQLPVMLTLIENIMKWLHTVAKQQRCRI
SEIKLDFDQVISGTGPSAFTEAILKDITKRTGKPMSWDIFHSMQESIVVGRVLVLTVEAF
AAGQGHSDSGTHDAKQALVKHHYHASGWPTTHPRFNHPIYGEVEKCNWVAECVKQWDEDT
AAFNALPQDQKIKQIAIKEQQVKEEERKQQEDRRKQEEEAARAALKAVAEGDGGNDAPAV
G

Enzyme Prediction     

No EC number prediction in ZTRI_6.240.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	84	171	9.7e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.42e-24	55	281	73	301	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.91e-12	81	170	2	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY25259.1|GT32	1.48e-307	1	421	1	421
SMR53774.1|GT32	1.48e-307	1	421	1	421
SMQ51614.1|GT32	1.48e-307	1	421	1	421
SMR56074.1|GT32	1.48e-307	1	421	1	421
UJO15252.1|GT32	2.08e-199	21	377	26	385

PDB Hits     

ZTRI_6.240.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.33e-37	56	328	134	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.66e-32	56	326	93	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.29e-26	64	300	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	5.04e-25	65	326	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.50e-06	65	159	58	143	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000008

TMHMM  Annotations     

Start	End
35	57