CAZyme Information: ZTRI_5.63.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_5.63.mRNA-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	Ztri_chr_5|CGC12	55856.84	4.7038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_5:302031-304721(-)

Full Sequence      

MKFTTLVLTAASLLTSSFTSAGATVPSFRLKPTPNTSWNIQLSSVPTLSSATTSPKPAIY
DVDLIDTPASLISSLHAANISVICYFSAGSYENWRSDASSWPKAALGKDMDGWEGEKWVD
VRSSGVRDVMKKRIALAKSKGCDGVDPDNIDGYNNDSGFPLTQSDAISFVTFLSTTAHAA
GLSYGLKNGGDIVPQVVNLAEWVINEECTFYNECELYKPFIDAGKAVLHIEYPDTKKKLS
EKQFIEFACKGKNQSGFSTLVKKRNLDASPPKVMASAGSDDGSFGDASSGEYDSDGMGFI
EESGTRLRAAAPEQALRDVHAENVMENEEISGLSPSARAFALAPSDVTALTLNEADIEAL
LSLLARVDAATTSPPSGTTAADRVKSMTAEDLRNLIVIVRSSAAMVLVRKNEKSAAEEKK
VENEKLLRSGGWSKGGDDDVDGAATSLATEETTLEYGKRQVDRCVAGAKTILAVRVQQRA
ASSGESEVTLLWRERMEWCEKVIVWLLVWLLEQKLNEA

Enzyme Prediction     

EC	3.2.1.109:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	38	232	2.5e-73	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	5.03e-107	37	268	1	221	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.61e-28	25	214	48	248	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR53338.1|GH114	1.16e-188	1	267	1	267
SMY24161.1|GH114	1.16e-188	1	267	1	267
SMQ50497.1|GH114	6.30e-186	1	267	1	267
SMR52198.1|GH114	2.47e-143	1	267	1	235
ADO71463.1|GH114	7.90e-75	31	268	84	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	4.03e-70	20	267	18	271	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	9.59e-70	31	267	52	288	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

ZTRI_5.63.mRNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000403	0.999584	CS pos: 23-24. Pr: 0.4923

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_5.63.mRNA-p1.