CAZyme Information: ZTRI_5.309.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_5.309.mRNA-p1
• CAZy Family: GH53
• CAZyme Description: similar to glucan 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		59420.49	5.8661

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_5:1118620-1120209(-)

Full Sequence      

MLAKAKSAFEHTFHPRLKDQVATHDGTHDAPSTIKPPTPTEVVRYRYHHGTNLGSIFVQE
MWLTGSMFAPDSTGISELAAVQGWVKSEGIEKTRARFEQHWQEYVSDADLDWLRDVAHCN
GVRLPIGYFTLGPDFCRDTPFGAVGDVYKNAWSAVKALVKRCHDRGIGVLVDLHGLPSGA
NGGDHSGTDSGAAQLWTSQPDKSLATRCVCYIVHELRCVDGILGVQIVNEAEANASGMYE
WYSSVLAEVSKVDSTMPIYISDAWNFGQAVTWVQQKNRVQEYRKNPVVIDAHLYWCFSDD
DKRKTPQQITAEVGTRLMELNGKSWSVLDRGAVNAVVGEYSCVLADESWSQSGGVSKDEL
VQKFGIAQSTYYQRNAAGSFFWTYRMDWMDYSGEWGFKQMNIQQAIKPPISLTFSVVEVQ
SRIAKAQGQRDDRRGQAYASHCQYWDANDPSDKYEHWRFQLGWDIGFSDAMSFFGMRSQR
NLQGGDKIGLLELWTLKRLEESGQVGQYGWEFETGLRQGITGFVEAADV

Enzyme Prediction     

No EC number prediction in ZTRI_5.309.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	96	390	2.5e-112	0.9897610921501706

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.15e-13	45	307	15	255	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.09e-04	103	384	22	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ50770.1|GH5_49	0.0	1	529	1	529
SMR53920.1|GH5_49	0.0	1	529	1	529
SMY24437.1|GH5_49	0.0	1	529	1	529
SMR52685.1|GH5_49	0.0	1	529	1	529
UJO12247.1|GH5_49	2.48e-234	2	529	5	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.11e-11	50	346	11	293	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	4.14e-11	50	346	11	293	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.24e-11	50	346	17	299	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	9.93e-11	50	346	16	298	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	9.97e-11	50	346	17	299	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74799|EXG3_SCHPO	1.45e-66	45	516	11	445	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|P38081|YBQ6_YEAST	1.81e-53	32	523	23	498	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|A2RAR6|EXGA_ASPNC	1.03e-16	50	305	44	288	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	2.27e-16	50	299	33	265	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|B8N151|EXGA_ASPFN	2.27e-16	50	299	33	265	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000057

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_5.309.mRNA-p1.