CAZyme Information: ZTRI_5.299.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_5.299.mRNA-p1
• CAZy Family: GH51
• CAZyme Description: similar to gpi mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		47893.45	10.0296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_5:1093286-1094655(+)

Full Sequence      

MSSTSVSWRPSTIFTIAIVFRLILLLYGRWQDAHSPVKYTDIDYLVFTDAARYVSYGKSP
YERATYRYTPLLAWLLIPTTWGGLWFEFGKALFAAGDIVTGWLILRILRTRGMETERALK
FASIWLLNPMVANISTRGSSEGLLAVLVVALLWAVLSRRIVLAGCLLGFAVHFKIYPFIY
AASIFWWLGSARLMDVNASVVQRAFSLINQDRVNMAVFSFLTFMGFNAVMYKMYGMPFIE
HTYTYHVSRIDHRHNFSVYNTVLHQSSMRGIDSGLKIESLAFLPQLLLSVVVIPLLMAKS
DLATTMLAQTFAFVTFNKVCTSQYFLWYMVFLPFYLPTSTLLRSPRLGVTALVLWILGQA
AWLQQGFELEFLGHSTFVPGLWLASIAFFLINCWLLGLIVRDVRSEPTALNASPSTSSKK
LK

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	134	399	1.9e-91	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.63e-80	1	422	1	437	GPI mannosyltransferase
252941	Mannosyl_trans	3.54e-68	134	400	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	4.97e-06	49	248	39	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR53900.1|GT50	4.72e-300	1	422	1	422
SMY24427.1|GT50	4.72e-300	1	422	1	422
SMR52675.1|GT50	2.20e-298	1	422	141	562
SMQ50759.1|GT50	2.75e-298	1	422	147	568
QRC91239.1|GT50	3.93e-182	10	417	10	429

PDB Hits     

ZTRI_5.299.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	3.65e-172	9	406	7	413	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	6.85e-172	9	403	7	428	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.06e-166	4	403	2	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	2.54e-165	9	402	25	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	4.47e-165	1	408	1	413	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000002

TMHMM  Annotations     

Start	End
13	30
83	105
140	162
166	188
217	239
281	303
324	342
378	400