CAZyme Information: ZTRI_5.263.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_5.263.mRNA-p1
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503	Ztri_chr_5|CGC4	55790.23	6.3311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_5:895621-897355(-)

Full Sequence      

MQNILTRVLALWQVPIVGHDHGATAVGSASSSYEPFSTRRIHPEYHNRRPPPKSQEWQND
RYDPYVCEALGHNGCWAPSEPGGGPPYMGPKSWPKRSKECIVPSKDDPTHDDAPAVIKAF
QDCCHDGHIIFENKTYHIGSVMNTTGLKDVDIEVRGLLKWSTNIDYWLAHSMPIGFQNQT
SAWHLGGEDIHFYGHGHGTLDGNGQVWYDFAKGVSNIHGRPHQITITNTKNSVIEGLRFV
QSQMWTMTVARSEKVLLQDIYVSSTSTDPAIRSNVNTDGCDTVYTNDITFLRWTITNGDD
SISMKQNSTNIYISNCTFYNGASLAMGSIGQYPGQIEIIENITATDIKMINTGYAGRIKT
WVGKNKGFPPNGGGGGLGHAKNITFRNFELEGVGTAWLITQCTFYDGPENAREVHQEAEP
DCTNSQFEISDLNWGDTHGTIRSERIAALQCSATKPCHNINIFNNSLTALDTKKPAETFL
CEQVKDTCGFTCTEECNGRCPRS

Enzyme Prediction     

No EC number prediction in ZTRI_5.263.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	128	487	2.3e-58	0.9446153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	7.95e-25	186	488	49	319	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	4.80e-20	104	460	75	401	polygalacturonase ADPG
215120	PLN02188	1.70e-19	196	485	128	391	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	1.24e-17	196	460	119	350	Probable polygalacturonase At3g15720
215426	PLN02793	2.82e-17	191	460	144	387	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ50721.1|GH28	0.0	1	503	1	503
SMR52638.1|GH28	0.0	1	503	1	503
SMR53829.1|GH28	0.0	1	503	1	503
SMY24389.1|GH28	0.0	1	503	1	503
UJO21971.1|GH28	1.79e-232	1	502	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	2.99e-32	100	498	19	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	1.54e-12	185	406	69	272	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1HG8_A	1.68e-09	185	488	66	347	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	2.44e-120	111	493	45	416	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|Q2EQQ2|RGXA_ASPNG	5.14e-68	111	485	42	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	5.48e-67	111	485	42	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	6.41e-64	111	484	41	428	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	6.41e-64	111	484	41	428	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999781	0.000263

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_5.263.mRNA-p1.