CAZyme Information: ZTRI_5.149.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_5.149.mRNA-p1
• CAZy Family: GT8
• CAZyme Description: similar to glycosyltransferase family 31 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	Ztri_chr_5|CGC9	56648.95	6.4976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_5:586204-587729(+)

Full Sequence      

MTRRALWQICLSIAVICSATIALLFWTDVPLKTIGFPGKQHNDEKKNPTSKYYSFRTYSA
FGTSINDTTSKSATREQLCEHFPKALLRDIQPVLKVGHGVVQTRARNSLNSCSACIDDLL
IFSDFDEELEGRPIINVISDLPAEHQEQEQLIPWKAMNGLPVNGSMMDPEITGRQGWELD
KFKFLLSISRAWRMRPEKRWYVFYEGDTFVVWDNVFRWLANFDPDTPQYFGSPSPGREDK
GERVWFANGGPGYIISRAAMRRLVKNDFDKTTGEYLGSKFTENHWGDVLTDCCGDSVLGW
ALWQEQVRISGVWPSMNPHPLHGVPFSDQHWCQPVMSMHKVHEKDMVDLWRWEWAHRDFK
RPFLYRDLALSYLNLTTMQRRNNWDNAAWDGFDAPADAPHVSADSCESACNSHGGCFQWT
YHRRRCTFVRSFRLGDAKEPTTPEPETDGEWTAEDQQFIAGWDTKSIAKWADERPCKEIQ
WLRPSISRII

Enzyme Prediction     

No EC number prediction in ZTRI_5.149.mRNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	9.71e-06	193	263	80	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR53498.1|GT31	0.0	1	490	1	490
SMY24261.1|GT31	0.0	1	490	1	490
SMQ50595.1|GT31	0.0	1	490	1	490
SMR52397.1|GT31	0.0	1	490	1	490
UJO24059.1|GT31	3.54e-190	4	489	17	505

PDB Hits     

ZTRI_5.149.mRNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08BL3|C1GTA_DANRE	9.16e-06	197	265	166	230	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A OS=Danio rerio OX=7955 GN=c1galt1a PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996058	0.003951

TMHMM  Annotations     

Start	End
5	27