CAZyme Information: ZTRI_4.663.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_4.663.mRNA-p1
• CAZy Family: GH5
• CAZyme Description: similar to glucose-methanol-choline (gmc) oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		69004.58	5.1537

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_4:2182780-2184795(-)

Full Sequence      

MGLKQFLPFGLFLLAAALPAAEIRQEQESEYEYIVVGSGAGGGPLASRLAREGHSTLLIE
AGDDQSSNPNTTVPIFQTLVSGDPALRWDFYVSHYQDQQQAQRDPKYSYDTPNGEYTGLT
PPSGATPKGVLYPRAGTLGGCVTHNALIFITAHDSDWDNIATLTGDASWSASNMGKYLDK
VYEWQSVNPTDPTILLKDLQLVRQLAGGAGVIAPGLDLLKPVVGLGTALLGDPNARLPNR
DSTEGFYPIPLIAEKGARKSVREHIKDTVAQGYPLTVKTDTFVTKVVFDKSGDEPKAVGV
EYLEGSYLYRASPRSSGRSGTPGSVNATKEVILAGGTYNTVQMLKLSGIGPKAELDSFDI
PILVDSPGVGTNMQDRYEIGLNVQHTKDFNILEGCTLDAKPHDECYKQWVSGAPVLAQRG
TYATDGLAATMVAHSDYAENSDVDMFIFGSPANFTGYFPQWYDHIVDQHNFYSWYTLKAH
TRNTAGTVKLRSADPLDVPEIAFNYFTSPGSDKDLASMVQALKMSRQALQRYNNDPILNL
LPGSKFEEFFPGPNVQSDAELGQYIKDRTWGHHAACSAPIGADGDRNAVLDSKFRVRGVK
GLRVVDASVFPKIPGVFIQAPIFVMSEKAADTILNG

Enzyme Prediction     

No EC number prediction in ZTRI_4.663.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	30	634	9.1e-98	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.03e-63	26	635	3	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.23e-59	28	634	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.10e-35	486	629	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.92e-24	27	625	52	568	Protein HOTHEAD
366272	GMC_oxred_N	1.48e-14	130	378	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY23860.1|AA3	0.0	1	636	1	636
SMR51166.1|AA3	0.0	1	636	1	636
SMR52146.1|AA3	0.0	1	636	1	636
SMQ50187.1|AA3	0.0	1	636	1	636
SMR49022.1|AA3	3.05e-315	42	636	42	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS1_AAA	4.13e-30	238	636	171	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	4.13e-30	238	636	171	562	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	4.13e-30	238	636	171	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	4.13e-30	238	636	171	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	4.60e-30	238	636	187	578	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4K4K7|BETA_PSEF5	4.00e-43	42	633	16	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	5.02e-40	134	633	83	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	1.72e-39	134	633	81	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	1.72e-39	134	633	81	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	2.34e-39	134	633	83	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.047894	0.952080	CS pos: 20-21. Pr: 0.7624

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_4.663.mRNA-p1.