CAZyme Information: ZTRI_4.640.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_4.640.mRNA-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
898		100676.95	5.5239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_4:2121974-2125681(-)

Full Sequence      

MPLLSSKLPKPSGQFDVGTIDIEALCERRRIDDFVFKATGRPAFEIETVLFALYYPAVKD
APSRGPQHSWVPKPISLTGEGYARFAKMSNWLTDNVFTFGLWMLAGSTIIPIEVDSPLHG
TVKNYRDYETEHPLDDYGLPEFPVIVMSHGMASSRMQYSQYCSELASRGFIVAAVEHRDG
SGPGTTIMTPDGKSRDVFHYEAGELEPTPDTPKYKELQLAFRQAEVEETARVLHMLNDGR
GAEVFRNNPRKEGIDLAEWRGRLNTKRMVIAGHSYGATLALQALKGAPSERLPFVGGVIL
DPGKQSGPLNDDIDVPVVVVHSQSWSAKHSIFQGRPHFEVVKDLVRKIIDEKKKYAWFVT
AKETSHPSVTDAPLIEPLLLAWTTGSTIDARQGVLQYVKITEQFLHFLETGDRKSILKEE
ISHPEYDESSRPFRGKIAKYLTPSPGTAKLLIIAGVTSFLLLALYGFGPSAVPFDLETFS
TPVELPQNPPCQLLPGAEDILVVMRTGATEIKDKLPAHIETTFKCFKNLVIFSDYNETFL
GYPVHDVLSNVNPEIKDTNQDFEIYRHIREVGREGLNESELSGAVSAESGPVGKNDNAGW
RLDKWKFLPMANETLHMYPDFKWYVFVEPDTYLVWSSLLQWLPTLDSGKASYFGSEVMIG
DDMFGHGGSSFVISKPALEKAAESYNKETQRWNDILAGHWAGDAVLGKLLDEAGARVTAT
FPMIQGGNFYDQMDWDGGNDHNGKLWCRPALSYHHFTPDEVREFWKFEQTFIQHALIEAS
EKESTLTAWREPPMAVLHHRDVFKLFVQPAIAEARKDWNNTAEQLVSEDTSVENCRNACL
AKDDCKQYAVGPAGCSIGNKVRIGSAQTGTEAWWLTERIQEWVYHKDKCHGQEGWSVS

Enzyme Prediction     

No EC number prediction in ZTRI_4.640.mRNA-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397462	PAF-AH_p_II	1.18e-31	5	302	6	253	Platelet-activating factor acetylhydrolase, isoform II. Platelet-activating factor acetylhydrolase (PAF-AH) is a subfamily of phospholipases A2, responsible for inactivation of platelet-activating factor through cleavage of an acetyl group. Three known PAF-AHs are the brain heterotrimeric PAF-AH Ib, whose catalytic beta and gamma subunits are aligned in pfam02266, the extracellular, plasma PAF-AH (pPAF-AH), and the intracellular PAF-AH isoform II (PAF-AH II). This family aligns pPAF-AH and PAF-AH II, whose similarity was previously noted.
226651	COG4188	1.44e-07	138	287	67	179	Predicted dienelactone hydrolase [General function prediction only].
223999	FrsA	7.26e-05	133	308	40	202	Fermentation-respiration switch protein FrsA, has esterase activity, DUF1100 family [Signal transduction mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY23835.1|GT31	0.0	441	898	4	461
SMR51141.1|GT31	0.0	441	898	4	461
SMQ50161.1|GT31	0.0	441	898	4	461
SMR52087.1|GT31	0.0	441	898	4	461
UJO10974.1|GT31	7.42e-149	490	898	82	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M07_A	1.96e-13	6	349	1	291	Crystal structure of Lp-PLA2 in complex with a novel covalent inhibitor [Homo sapiens],6M07_B Crystal structure of Lp-PLA2 in complex with a novel covalent inhibitor [Homo sapiens]
6M06_A	1.99e-13	6	349	1	291	Crystal structure of Lp-PLA2 in complex with a novel covalent inhibitor [Homo sapiens],6M06_B Crystal structure of Lp-PLA2 in complex with a novel covalent inhibitor [Homo sapiens],6M08_A Crystal structure of Lp-PLA2 in complex with a novel covalent inhibitor. [Homo sapiens],6M08_B Crystal structure of Lp-PLA2 in complex with a novel covalent inhibitor. [Homo sapiens]
3D59_A	2.17e-13	6	349	8	298	Crystal structure of human plasma platelet activating factor acetylhydrolase [Homo sapiens],3D59_B Crystal structure of human plasma platelet activating factor acetylhydrolase [Homo sapiens],3D5E_A Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by paraoxon [Homo sapiens],3D5E_B Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by paraoxon [Homo sapiens],3F97_A Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by soman [Homo sapiens],3F97_B Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by soman [Homo sapiens],3F98_A Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by tabun [Homo sapiens],3F98_B Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by tabun [Homo sapiens],3F98_C Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by tabun [Homo sapiens],3F9C_A Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by diisopropylfluorophosphate [Homo sapiens],3F9C_B Crystal structure of human plasma platelet activating factor acetylhydrolase covalently inhibited by diisopropylfluorophosphate [Homo sapiens]
5I8P_A	2.25e-13	6	349	13	303	Crystal structure of LP_PLA2 in complex with novel inhibitor [Homo sapiens],5I8P_B Crystal structure of LP_PLA2 in complex with novel inhibitor [Homo sapiens],5I9I_A Crystal structure of LP_PLA2 in complex with Darapladib [Homo sapiens],5I9I_B Crystal structure of LP_PLA2 in complex with Darapladib [Homo sapiens],5YE7_A The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens],5YE7_B The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens],5YE8_A The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens],5YE8_B The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens],5YE9_A The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens],5YE9_B The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens],5YEA_A The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens],5YEA_B The crystal structure of Lp-PLA2 in complex with a novel inhibitor [Homo sapiens]
5JAD_A	2.25e-13	6	349	9	299	Compound binding to Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2)discovered through fragment screening [Homo sapiens],5JAH_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAL_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAN_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAO_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAP_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAR_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAS_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAT_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5JAU_A Exploitation of a Novel Binding Pocket in Human Lipoprotein-Associated Phospholipase A2 (Lp-PLA2) Discovered Through X-Ray Fragment Screening [Homo sapiens],5LP1_A CRYSTAL STRUCTURE OF HUMAN LIPOPROTEIN-ASSOCIATED PHOSPHOLIPASE A2 IN COMPLEX WITH A [1.1.1]BICYCLOPENTANE-CONTAINING INHIBITOR AT 1.91A RESOLUTION. [Homo sapiens],5LYY_A Fragment-based inhibitors of Lipoprotein associated Phospholipase A2 [Homo sapiens],5LZ2_A Fragment-based inhibitors of Lipoprotein associated Phospholipase A2 [Homo sapiens],5LZ4_A Fragment-based inhibitors of Lipoprotein associated Phospholipase A2 [Homo sapiens],5LZ5_A Fragment-based inhibitors of Lipoprotein associated Phospholipase A2 [Homo sapiens],5LZ7_A Fragment-based inhibitors of Lipoprotein associated Phospholipase A2 [Homo sapiens],5LZ8_A Fragment-based inhibitors of Lipoprotein associated Phospholipase A2 [Homo sapiens],5LZ9_A Fragment-based inhibitors of Lipoprotein associated Phospholipase A2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VDG7|PAFA2_MOUSE	3.38e-19	46	381	29	327	Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Mus musculus OX=10090 GN=Pafah2 PE=1 SV=2
sp|P79106|PAFA2_BOVIN	6.20e-19	51	405	34	357	Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Bos taurus OX=9913 GN=PAFAH2 PE=1 SV=1
sp|P83006|PAFA2_RAT	8.39e-18	46	405	29	355	Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Pafah2 PE=1 SV=2
sp|Q99487|PAFA2_HUMAN	6.57e-17	51	405	34	357	Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=PAFAH2 PE=1 SV=1
sp|P70683|PAFA_CAVPO	9.42e-16	8	352	56	345	Platelet-activating factor acetylhydrolase OS=Cavia porcellus OX=10141 GN=PLA2G7 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_4.640.mRNA-p1.