CAZyme Information: ZTRI_4.53.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_4.53.mRNA-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832		90790.83	5.3670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_4:311710-315554(-)

Full Sequence      

MVFHKPLAALAMLLQGISAFGIDYTAAPPNLTTLFNNTLFYTWRPKAHVLAPSAHIGDPC
MQYTDPSTGLFHAGYLYSGGAGESGAAAGTTGDLITYLDVNQDPTFIRRGGINDPVAVFD
GSVIPAGINGSATLLYTSVAYLPIQWTIPYVKGSETQSLAVSSDGGRNFTKLEFGPVIPG
PPFPLTNVTGFRDPYVFQSPQLDRALSSQENTWYNIISGGVHGLGPSLFLFRQYDADFRD
WEYLGELWHEQANSSWGDGTWAGRWGYNFEVGNIFGLDEDGYNAEGEIFTTTGAEWSEEP
IIPQVSQFREMLWTAHTLDTSSNGSVSLVATMAGKLDWGAFAYAAAGKILPANSSASQAS
GVFHDRFITYLWLTGDNFGTSDFPKAQQGWDGSLTTVRELSVGTISGVVNNDLVNETGSW
RFSNSSDSTASTVELTTLKQTIAREVYAKIVSNAERTFVEPACNVVNGSGVEAFQQSPIS
KFFMLTTTIRFPSSARTSGVKAGLRILGSEHEHTDIYYQFSNESMIVDRSNSSAAAATTP
GILANNEAGRFRLFDIATGAGNGSSIEALNLTIIVDNSIVEVYANGRFALSTWVWSWYEE
STQISFFYEEADGVQYDNTTVYEDFCGTRGHYCAPDEQCTRQNTCEKYCEAGGTWCPAGQ
HCVEAGYAGSGEFHCHFPQTAAKLAYRNHTSTSSSYQQFRKVQAPCSTPASQQCPLAYVS
RFVTTSSAPTTRKSAEQHHYWLDNVAKDRAGPRGLRFGMHCGLDSLDRTRILRKTQEGED
VSSLRDPVEFSRIVAMTALALFRAFPTGASHFITKSSRHLRAQSLTGGTHSR

Enzyme Prediction     

EC	3.2.1.26:10	2.4.1.100:6	2.4.1.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	48	402	2.7e-34	0.9590443686006825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350133	GH32_XdINV-like	6.54e-114	55	404	2	337	glycoside hydrolase family 32 protein such as Xanthophyllomyces dendrorhous beta-fructofuranosidase (Inv;Xd-INV;XdINV). This subfamily of glycosyl hydrolase family GH32 includes fructan:fructan 1-fructosyltransferase (FT, EC 2.4.1.100) and beta-fructofuranosidase (invertase or Inv, EC 3.2.1.26), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. Xanthophyllomyces dendrorhous beta-fructofuranosidase (XdINV) also catalyzes the synthesis of fructooligosaccharides (FOS, a beneficial prebiotic), producing neo-FOS, making it an interesting biotechnology target. Structural studies show plasticity of its active site, having a flexible loop that is essential in binding sucrose and beta(2-1)-linked oligosaccharide, making it a valuable biocatalyst to produce novel bioconjugates. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
214757	Glyco_32	5.84e-34	90	586	44	436	Glycosyl hydrolases family 32.
350110	GH32_FFase	1.18e-29	90	402	38	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
400517	Glyco_hydro_32C	4.15e-26	445	623	1	162	Glycosyl hydrolases family 32 C terminal. This domain corresponds to the C terminal domain of glycosyl hydrolase family 32. It forms a beta sandwich module.
224536	SacC	7.91e-16	42	585	27	447	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR50522.1|GH32	0.0	61	623	1	563
SMQ49530.1|GH32	0.0	61	623	1	563
SMR51459.1|GH32	0.0	61	623	1	563
UPK90714.1|GH32	1.57e-252	18	623	18	608
AAQ31829.1|GH32|3.2.1.26	9.48e-250	22	623	15	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XH8_A	7.87e-245	22	623	5	594	Aspergillus kawachii beta-fructofuranosidase complexed with glycerol [Aspergillus luchuensis IFO 4308],5XH9_A Aspergillus kawachii beta-fructofuranosidase [Aspergillus luchuensis IFO 4308],5XHA_A Aspergillus kawachii beta-fructofuranosidase complexed with fructose [Aspergillus luchuensis IFO 4308]
3LF7_A	5.75e-210	19	623	1	625	Crystal structure of fructosyltransferase (wild-type) from A. japonicus [Aspergillus japonicus],3LFI_A Crystal structure of fructosyltransferase (wild-type) from A. japonicus in complex with glucose [Aspergillus japonicus],3LFI_B Crystal structure of fructosyltransferase (wild-type) from A. japonicus in complex with glucose [Aspergillus japonicus]
3LDK_A	9.22e-209	19	623	1	625	Crystal Structure of A. japonicus CB05 [Aspergillus japonicus],3LDR_A Crystal structure of fructosyltransferase (D191A) from A. japonicus in complex with 1-Kestose [Aspergillus japonicus],3LEM_A Crystal structure of fructosyltransferase (D191A) from A. japonicus in complex with Nystose [Aspergillus japonicus],3LIG_A Crystal structure of fructosyltransferase (D191A) from A. japonicus [Aspergillus japonicus],3LIH_A Crystal structure of fructosyltransferase (D191A) from A. japonicus in complex with raffinose [Aspergillus japonicus]
5ANN_A	4.38e-76	22	602	44	608	Chain A, Beta-fructofuranosidase [Phaffia rhodozyma],5ANN_B Chain B, Beta-fructofuranosidase [Phaffia rhodozyma]
6S82_A	4.38e-76	22	602	44	608	Chain A, Beta-fructofuranosidase [Phaffia rhodozyma],6S82_B Chain B, Beta-fructofuranosidase [Phaffia rhodozyma]

Swiss-Prot Hits     

ZTRI_4.53.mRNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999738	CS pos: 19-20. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_4.53.mRNA-p1.