CAZyme Information: ZTRI_4.22.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_4.22.mRNA-p1
• CAZy Family: GH47
• CAZyme Description: similar to glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570		61341.93	4.9328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_4:76278-78109(+)

Full Sequence      

MAPAQEHYDFIIVGGGTAGCLLAHRLSHSAAAPSVLLLEAGTKPSGPYLSAPGHRYTAAF
ARSDLDHGYVSEPEPSLNDRELPYARGKGLGGSSILNFGVYLYGSSEDYDRWADLVDDDD
WAWSSVQESFRTIENYATEGAAAYEHLADPASGRHGTSGQVTVSLPAVLEKSVAPQMASL
LAAGESLCLDPNAGDNIGVSLFPYSYGKSGRCTSAIAHLVDPPKNLEVWIDATVGKLLFD
GTSVIGIRTIDGREALSSKEVILCCGAIDTPRLLLLNGIGPKAELEALDIEVKRDLPGVG
KHLRDHVAGIMCVEVDGSFNDRTTFETDPNSVEEAQALWDRDHTGALSLQHSSLWGGFLK
VPDLANSSEFQDLAPADQEFLTRSKVPHFEFLNNALLWPPGSQLTPGNTYLSFTAALMNA
QSEGSVTLRSNNPADKPLLRLNLLSHPYDVLVIREAIRRSWNMIIENPDMRPHVRKTLSG
PVSLSDADIDAYAKAEACPIWHANGTVRMGKEADGGSVDSSGKVYGVQGLRVADLSVCPL
TTNNHTQATAYLVGQKIAEKMVREYKLASC

Enzyme Prediction     

No EC number prediction in ZTRI_4.22.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	561	2.6e-147	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.06e-90	4	561	2	531	choline dehydrogenase; Validated
225186	BetA	9.92e-89	1	569	1	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.05e-34	421	557	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.04e-31	6	564	54	579	Protein HOTHEAD
366272	GMC_oxred_N	1.86e-23	75	308	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR50493.1|AA3_2	0.0	1	570	1	570
SMQ49497.1|AA3_2	0.0	1	564	1	564
SMR51427.1|AA3_2	0.0	1	564	1	564
SMY23191.1|AA3_2	0.0	1	564	1	564
QRC97674.1|AA3_2	2.33e-272	1	567	1	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.15e-61	8	559	2	559	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.25e-61	8	559	3	560	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.99e-57	3	565	36	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6ZE2_A	2.09e-46	5	568	3	589	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6ZH7_A	1.51e-45	2	558	2	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	7.62e-61	8	559	5	525	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.29e-60	8	569	2	535	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q6D6D9|BETA_PECAS	9.84e-59	8	567	3	535	Oxygen-dependent choline dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=betA PE=3 SV=1
sp|A4XPI5|BETA_PSEMY	4.11e-58	5	561	2	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=betA PE=3 SV=1
sp|B2JS89|BETA_PARP8	9.06e-58	4	561	2	532	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000007

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_4.22.mRNA-p1.