CAZyme Information: ZTRI_3.932.mRNA-p1

Basic Information

• Species: Zymoseptoria tritici
• Lineage: Ascomycota; Dothideomycetes; ; Mycosphaerellaceae; Zymoseptoria; Zymoseptoria tritici
• CAZyme ID: ZTRI_3.932.mRNA-p1
• CAZy Family: GH43
• CAZyme Description: similar to cell wall glycosyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		45646.57	5.0302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ZtriticiIPO323	11839	336722	13	11826

• Gene Location: location=Ztri_chr_3:2908818-2910150(+)

Full Sequence      

MKLKLWTFILCLGLATSEADALHCPVDIGIKGLGGRMVDSSISRGQGNTASNGSTGFIEQ
GIFQQSLRESIAFYTENSTQTAIWEAYLQNSLESAVESLSNVTPAAGLPLDRLSIGTNMI
HQYLRTKDETFLPAICALSQSVVLQEQNANGGLWYYANRKNISAYQNLSYVDGMYSYPAF
AILTSPDATNDTAVTRVGDRFGAAAAFKQLEILRNITQRPDGLLLHGYDAIKNHTWADPT
TGASPEVWARAQAWYTIGTLEVLELLLSAGNTGDAFEAIKAIFIVLVRAQVRASGKSLSI
TGTYGVWQVVDQPGASFDGYENFIETSSSCMTAYALLKAVRLGILQDATLAGQALDTGLG
IYQRVLRGSLIHNGNGTLSLNGTSSVASLSGDVSAQYYVTRPTVLNSLIGTSAFTLASLE
VERIC

Enzyme Prediction     

No EC number prediction in ZTRI_3.932.mRNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	78	423	1.6e-41	0.9096385542168675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.82e-29	110	423	79	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	4.85e-29	110	423	72	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMY22959.1|GH105	9.65e-306	1	425	1	425
SMQ49260.1|GH105	6.12e-293	1	425	1	425
SMR49088.1|GH105	1.89e-292	1	425	1	427
SMR50265.1|GH105	4.26e-289	1	425	1	427
UJO17900.1|GH105	1.95e-131	15	425	17	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.24e-22	110	424	74	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.07e-17	110	422	87	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.35e-17	110	422	77	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0A3U6|PIC1_AGRFC	2.73e-23	206	420	22	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.73e-23	206	420	22	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|O34559|URHG2_BACSU	5.48e-17	110	422	87	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999749	CS pos: 21-22. Pr: 0.8098

TMHMM  Annotations     

There is no transmembrane helices in ZTRI_3.932.mRNA-p1.